KEGG   Pseudomonas putida ND6: YSA_05723Help
Entry
YSA_05723         CDS       T02170                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppi  Pseudomonas putida ND6
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YSA_05723
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YSA_05723
   00630 Glyoxylate and dicarboxylate metabolism
    YSA_05723
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YSA_05723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3101675..3103852)
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQCYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAIDADDKVIVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFAAEIFSQVEDLLGM
PRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILAIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESL
KRMAVVVDQQNAGDALYRPMAPNFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgtacgacttcgtg
aacaacgaagccatccccgggaccggcatcgtcgccgagcagttctgggcgggtgcagag
aagatcatcaatgacctcgctccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcccacgacgccgcagcc
tacaaagcattcctccaggaaatcggctacctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaatcgcccacatggccggcccacaactggtcgttccg
gtgatgaacgcccgcttcgccctgaacgccgccaacgcccgctggggttcgctgtacgac
gccctttacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggccagtgttac
aacaaggtacgcggcgacaaggtcatcgccttcgcccgcgccttccttgacgaagccgcg
ccactggccgccggctcgcacgttgactccacgggctaccgcatcgaaggcggcaagctg
gttgttgccttgaaaggcggcagcaacagcggcctgcgcgacgatgcgcaactgatcggc
ttccacggcgacgccgccgcgccgactgccgtgctgctcaagcacaacggcctgcacttc
gaaatccaggtcgatgccagcacccccgtcggcagcaccgacgccgctggcgtcaaagac
atcctgatggagtcggcactgaccaccatcatggactgcgaagactcggttgcagccata
gacgctgacgacaaagtcatcgtctaccgcaactggctgggcttgatgaaaggcgacctg
gccgaaagcgtgagcaagggtggcaaaaccttcacccgcaccatgaacccggaccgcgag
tacgcggcgcctaacggcggcagcgtgaccctgcacggtcgttcgttgctgttcgtgcgc
aacgttggccacctgatgaccaacccggcgatcctcgatgcccaaggcaacgaaatcccc
gaaggtatccaggacgggctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaatacccgcagcggcagcgtgtacatcgtcaagccgaagatgcacggc
cctgaggaagtggccttcgccgctgagatcttcagccaggtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggaacgccgtaccacggtcaacctc
aaatcctgcatcaaggcagccgccgagcgcgtggcgttcatcaacaccggcttccttgac
cgcactggcgatgaaatccacacctcgatggaagccggcgccgtggtgcgcaaaggtgcc
atgaagaacgagaagtggatcggcgcctacgaaaacaacaacgtcgacgttggcctggcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgcctgacctgatg
gccgccatgctcgagcagaagatcgcccacccactggccggtgccaacaccgcctgggta
ccgtcgccaactgccgccaccctgcacgccctgcactaccacaaagtggacgtacaggcg
cgccagcgtgaactggcttcacgcaccccggcgtcggtggacgacattctggccattccg
ctggctgccgacaccaactggtcggccgaagagatccgcaacgagctggacaacaacgcc
cagggcattctcggctacgtggtgcgttggatcgaccagggcgtgggttgctcgaaggtg
ccggacatcaacaacgtcggcctgatggaagaccgtgccaccctgcgcatctccgcccag
ctgctggccaactggctgcgccacggcgtggtcagccaggagcaggtgctggaaagcctc
aagcgcatggccgtggtggtcgatcagcagaacgctggcgacgccctgtaccgcccgatg
gcgccgaacttcgacgacaacgtggcgttccaggcggctgtggaactggtggtggaaggt
ggcaagcaaccgaacggttataccgaaccggtactgcaccgccgtcgccgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system