KEGG   Pseudomonas putida ND6: YSA_05797Help
Entry
YSA_05797         CDS       T02170                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppi  Pseudomonas putida ND6
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YSA_05797
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     YSA_05797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3145553..3146062
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQAVGIKSGPFINFVVTGQ
TALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLVLPRAEILKNAF
VLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFEWRGLQLTPA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgagcacggtttacctgggcctgggcagcaatatcgaccgtgaggcgcatttg
tgcgccgggctcgatgcgttggctggcatcctgaccgacatgcgctgttcgccggcattc
gaaagccaggcggtgggcatcaagagcgggccgttcatcaacttcgtggtgaccgggcaa
accgcgttgccgttgatcgagctggaccgccggctgaagttcatcgaggccgacaatggc
cgctatgccccggaccgcaaagggttgccgctggatatcgacgtgctgatgtatgacgat
ttgcacggtaccttcgatgggctggtattgcctcgtgccgagatcctgaagaacgctttt
gtgctgtggccgctgtcgttgctggcacccgacctggtgcatccgggggtgggcaagcgc
atggcgcagctgtggcaggaagcgcagatcgatcaggtgctggccccggtcgcctttgag
tggcgcgggttgcagttgacgcccgcttaa

DBGET integrated database retrieval system