KEGG   Pseudomonas putida ND6: YSA_05854Help
Entry
YSA_05854         CDS       T02170                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01130  Biosynthesis of antibiotics
ppi01230  Biosynthesis of amino acids
Module
ppi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YSA_05854
Enzymes [BR:ppi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     YSA_05854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFK69939
UniProt: I3UWR8
Position
3179048..3179881
Genome map
AA seq 277 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKGADAPRGFANALIEQAKRKQPAVIA
EIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAITESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccgacggtgctggaaaggatcattgcccgcaagttccaggaagtggccgag
cgcagtgcgcgcgtcagcctcgccgaactggagggcctggccaagggcgctgacgccccg
cgaggcttcgccaatgcgctgatcgagcaggccaagcgcaagcagccagcggtgattgcc
gaaatcaagaaagcgtcgccaagcaagggcgtgatccgcgagcacttcgtgccagcggaa
atcgcggtcagctacgagaagggcggggccacctgcctgtcggtgttgaccgatgtcgat
tatttccagggtgccgatgagtacttgcagcaggcccgcgcggcggtttcgctgccggtg
atccgcaaggacttcatggtcgacccttaccagatcgtcgaagcccgggccctgggcgca
gattgcgtactgctgatcgtgtcggcgctggatgacgtgaagatggctgaactggcggcc
accgccaaggacgtcggcctcgacgtgctggtagaagtgcacgatggcgatgaactggag
cgcgcgcttaaaaccctggatacaccgctggttggggtgaacaaccgcaacctgcacacc
ttcgaggtcagcctggaaaccacccttgacctgctgccgcgcattccgcgcgaccgtctg
gcgattaccgaaagcggtattcttaaccgggccgatgtggagctgatggcaatcaacgag
gtttactcgttcctggtgggagaggcgttcatgcgcgccgagcagcctggcctggaatta
cagcggctgttcttccccgagcaggtgaagaagactgttcagcaattggactga

DBGET integrated database retrieval system