KEGG   Pseudomonas putida ND6: YSA_06398Help
Entry
YSA_06398         CDS       T02170                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00260  Glycine, serine and threonine metabolism
ppi00750  Vitamin B6 metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01230  Biosynthesis of amino acids
Module
ppi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YSA_06398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YSA_06398
Enzymes [BR:ppi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YSA_06398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFK70216
UniProt: I3UXJ5
Position
3440208..3441596
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRALVSDSYRGFRHRGIAPLQQLGHNEWILQLFHGPTRSSKDFAAQLQA
RFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGLLALYPSAGTPADRAAVMRSA
ASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEACGELSIGNRQWLHARMLFDSY
AVDDVLIREEIVTLFHETGSAVDPHAATGVFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPAGAVGTAGDGPLLAADDLAGVHALLARLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggtcgatttccgcacggcattgctt
tctggcctggccgacgatggcgggctttatgtgcccacctcggtgccggtgttcagccca
caggaaattgccagctggtcgtggttgcccttcgacgaactggcctggcgggtaatggca
ccgtttgtcggcgataccctcgacgagcctaccctcagggcgctggtcagcgacagctat
cgcgggttccgccaccgcggcattgcgccgttgcagcagcttggccataacgaatggatc
ctgcagcttttccatgggcctacccggtcctccaaggactttgccgcgcagttgcaggcg
cgttttgtccggcactttctgggggcggagtgcgagcgggtcatgctggtcggtgccagc
aacggcgataccgcagtagcggctatcgaagcgttgcggcattgcccggcagcaggcttg
ctggcgctataccccagcgcaggcacgcccgccgaccgcgcggcagtgatgcgcagcgcc
gcgtccgacagcgtaagctgtgtggccgtggatggcagctttgacgattgccagtcgctg
gtgtcggcgctgctgcgtgactggccatgccccgggctgattccggtcagcttcaactcc
accaactgggtcggtgtgctggcgcagatcgtgttctatttccatgcggcgctgcagctc
ggtggcgggatacgcccggtcgggttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccgatcaaccagatcatcgtctccaccaac
cgcaacgatgccttgcaccggttcatccactgcaaccgctacagccgtggctccaccagc
cagaccttgtcaccggtcatggacttttcgctgttctccaacctggagcgcttcgtctgg
gaactgtatgaccgcgatggcggggcaacccgggcactgatggagcacttcgaggcgtgt
ggcgagctgagcatcggcaaccgccagtggttgcatgcgcgcatgctgttcgactcctat
gccgtggacgacgtgctgattcgcgaagaaattgtcacgctgttccacgaaacgggcagc
gcagtagaccctcatgccgcgacaggggtattcgccgggcgcctgcaccggcgcaacatc
ggtgcgcccatcgtcacgctggggcaatttgcccccgaaaagtctgccgggctgctggcg
gagctgggggcctggcacggtgaggtgcccgccggcgcggtcggcacagcgggtgatggg
ccgctgttggcagctgacgacctggccggtgttcatgccttgttggcccggttgcaggct
gggcgatga

DBGET integrated database retrieval system