KEGG   Pseudomonas putida ND6: YSA_06450Help
Entry
YSA_06450         CDS       T02170                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppi  Pseudomonas putida ND6
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3468856..3470055
Genome map
AA seq 399 aa AA seqDB search
MQYTKRRSLERRFCIHGIYRFDIGWKKMRSKVTGAKRWVVKIGSALLTADGKGLDRGAMA
VWVEQMVALREAGVELVLVSSGAVAAGMSQLGWTKRPSAMNELQAAASLGQMRLVQAWES
SFGEHGKHTAQILLTHDDLSDRKRYLNARSTLRTLVDLGVVPVINENDTVVTDEIRFGDN
DTLAALVANLVEADLLVILTDRDGMFDADPRNNPEAQLIYEARADDPSLDAVAGGTGGAL
GRGGMQTKLRAARLAARSGAHTIIIGGRIERVLDRLKAGERLGTLLSPERGMLAARKQWL
AGHLQTRGTLVLDAGAVQALRQANKSLLPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLA
NYSALEAQKIIGQSSEAIESILGYSAEPELVHRDNLVLV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtacactaaacgccgctctctggagcggcgtttttgtatccacggtatctacaga
ttcgacataggttggaagaagatgcgaagcaaggtgacgggcgccaagcgctgggtcgtt
aagattggcagtgctctgctgaccgccgatggcaagggcctcgaccgcggtgcaatggcc
gtttgggtcgagcagatggtcgcgctgcgtgaggcaggcgtggagttggtactggtctcc
tccggggccgtggctgccggcatgagccagctgggctggaccaagcgaccgagtgcgatg
aacgagctgcaggcggctgcctcgctcggccagatgcgcctggtgcaggcctgggagtcg
agcttcggggagcacgggaagcacaccgcgcaaatcctgctgacccatgacgacctgtcc
gaccgcaagcgttacctgaatgcccgcagcaccctgcgcaccttggtcgatctgggtgtg
gtgccggtgatcaacgaaaacgacaccgtggtcactgacgagatccgctttggcgacaac
gacaccctggcggcgctggtggccaacctggtcgaggccgacctgctggtgatcctcacc
gaccgcgatggtatgttcgatgccgacccgcgcaacaaccccgaggcgcagttgatctac
gaagcccgtgccgacgatccctcgctggatgccgtggccggtggtaccggtggtgccctg
ggccgtggcggcatgcagaccaagctgcgtgcggcgcgcctggctgcccgttccggtgcc
cacaccatcattatcggtggccgcatcgagcgtgtgctggaccgtctgaaggcgggcgag
cgcctgggcaccttgctgtcccctgagcgcggcatgctcgcggcgcgcaagcagtggttg
gccggtcacctgcaaacccgtggcaccctggtgctggatgctggtgccgtgcaagcgctg
cgtcaggccaacaagagcttgctgccggttggcgtgaagactgtgcagggcagcttccgt
cgtggcgagatggtggtgtgcgtcggcccggacggtgttgaagtggctcgcggcctggcc
aactacagcgccttggaggcgcagaagatcattggtcagtcgtccgaagccatcgagtcg
atccttggctacagcgccgagccggaacttgtacaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system