KEGG   Pseudomonas putida ND6: YSA_07012Help
Entry
YSA_07012         CDS       T02170                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppi  Pseudomonas putida ND6
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3789623..3790888
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNAALPILAATLLADGPVTVGNLPHLHDITTMIELFGRM
GIEPVIDEKLSVEIDPRTIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAKIEVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFINAMGGNIQGAGTDTITIDGVERLDSANYRVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLKEAGADINTGEDWIELDMHGKRPKAVNLRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYEMHRMGAQIQVEGNTAIVTGV
KALKGAPVMATDLRASASLVLSALVAEGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgattattactggcggcgctcgccttgacggcgagatccgcatttcgggc
gcgaaaaacgcagccctgccgattctggcagcgaccctgctggccgatggcccggtcacc
gtgggcaacctgccgcacctgcacgacatcaccaccatgatcgagctgttcgggcgcatg
ggcatcgagcctgtgatcgacgaaaagctgtcggtggagatcgatccacgcaccatcaag
accctggtcgcgccgtacgagctggtcaagaccatgcgcgcctcgatcctggtgctgggc
ccgatggttgcccgtttcggcgaagccgaagtggccctgcctggcggttgcgccattggc
tcgcgcccggtcgatctgcacatccgtggccttgaggccatgggggcgaagatcgaagtg
gaaggcggctacatcaaggccaaggcgcctgaaggtggcctgcgtggcgcgcacttcttc
ttcgacaccgtcagcgtgaccggtaccgagaacatcatgatggccgctgccttggccaag
ggccgcagcgtgttgcagaacgccgcgcgtgagcctgaagtggtcgatctggccaacttc
atcaacgccatgggcgggaacattcagggcgcaggtaccgacaccatcaccatcgacggt
gtcgaacgactggattcggccaactaccgcgtcatgccggaccgcatcgagaccggtacc
tacctggttgccgctgccgtgaccggtggccgcgtcaaggtcaaggacaccgaccctacc
atccttgaagccgtgcttgaaaaactcaaggaagcgggtgccgacatcaacaccggcgag
gactggatcgaactggacatgcatggcaagcggccgaaagccgtgaacctgcgtactgcc
ccgtatccggcgttcccgaccgacatgcaggcgcagttcatctcgctgaacgccattgcc
gaaggcactggcgcggtaatcgagaccatcttcgaaaaccgcttcatgcatgtttacgaa
atgcaccgcatgggcgcgcagatccaggtcgaaggcaacaccgccatcgtcactggcgtc
aaggcgctgaagggtgccccggtcatggccaccgacctgcgtgcttccgccagcctggtg
ctgtcggcgctggttgccgaaggcgataccctgatcgatcgcatctaccacatcgaccgt
ggttacgagtgcatcgaggaaaaactgcagatgctcggcgcgaaaatccgccgcgtaccg
ggctag

DBGET integrated database retrieval system