KEGG   Pseudomonas putida ND6: YSA_07018Help
Entry
YSA_07018         CDS       T02170                                 

Definition
HisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppi  Pseudomonas putida ND6
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3791902..3793227
Genome map
AA seq 441 aa AA seqDB search
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIDDLILNRARLELALTRITPVQREALEKAANRVRIYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVAEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLMPTMER
ADIIEKSINGRGALIQVRDMQQAMDVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQEKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccactgcaattgcccgtctcaacgccgctgatccggatttcgcccgacat
ctggatcatctgctgagctgggaaagtgtgtccgatgacgcggtcaatcagcgcgtgctc
gacatcatcaaggccgtgcgtgaacgcggtgatgcggcgctggtggaattcacccagcgc
ttcgatggtgttgacgccaagtcgattgacgacctgatcctcaatcgcgcgcgcctggaa
ctggcgctgacccgtattaccccggtccagcgcgaggccctggaaaaggccgccaaccgt
gtgcgcatttatcacgagcggcagaagcaggattcctggcagtacaccgaggccgacggc
accgtgctcggccagaaggtcaccccgctggaccgtgctggcctgtatgtgccgggcggc
aaggcgtcgtacccgtcgtcggtgctgatgaacgccatcccggccaaggttgccggcgtg
gctgaagtggtgatggtggtaccgaccccgcgtggtgaggtcaacgagctggtgctggcg
gctgcctgcatcgccggtgtcgaccgggtgttcaccgtcggtggtgcccaggccgtggct
gcgctggcctacggtactgaaagcgtgccgcaggtggacaagatcgtcggcccgggcaac
atctacgttgccaccgccaaacgccacgtgttcggccaggtcggcattgacatgatcgcc
ggcccctcggaaattctcgtggtgtgcgacggtcagaccgacccggactggattgccatg
gacctgttctcccaggccgagcacgacgaagacgcccaggccatcctggtcagcccggat
gccgccttcctcgatcgtgtggctgccagcatcgacaagctgatgccgaccatggaacgt
gccgatatcatcgagaagtcgatcaatggccgtggtgcgctgatccaggtgcgtgacatg
cagcaggccatggacgtggccaaccgcattgcaccggagcacctggagctgtcggtggcc
gacccgcaagcctggctgccacacattcgccacgctggcgcgatcttcatgggccgccac
accagcgaagcgctgggcgattactgcgctggccctaaccacgtgctgcccacttcaggt
accgcgcgtttttcgtcgccgctgggggtgtatgacttccagaagcgttcgtcgatcatc
ttctgctccgaacagggcgcgtccgaactgggccacactgcctcggtcctggctcgtggc
gagtcgctgaccgcccacgcccgcagcgctgaataccgtatcctgacccaagagaagggg
aactga

DBGET integrated database retrieval system