KEGG   Pseudomonas putida ND6: YSA_07102Help
Entry
YSA_07102         CDS       T02170                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YSA_07102
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_07102
   00052 Galactose metabolism
    YSA_07102
   00500 Starch and sucrose metabolism
    YSA_07102
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_07102
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YSA_07102
   00524 Butirosin and neomycin biosynthesis
    YSA_07102
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YSA_07102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3839921..3840880
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATADYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLEVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEYSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaggtaaacgttttcgccaccgcggactacaccaaccccgagcag
gccatcgaggcctacctggaaagccaaggtatcgcccgtggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagccgcacggcattttgcaagaccttggaggtcgagcgactgttgctgatcaatgat
ttcaccgctatggcgctgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgtctgggcgaacagcactggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggccatgtcagcgccgaggccgttctcagtgggggggggctggtgcggttgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gacgccgcactgggcggtgagccacgggcgctggcggtggtcgagcagttctgtcgtttc
cttgggcgcgtggcgggtaacaatgtgctgacgctgggcgcgcgaggcggggtctatatt
gtgggcggtgtgattccgcgctttgccgagctgttcctgcgcagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaccggggtgccggtgtggctggtgacg
gcggaatattccgggttggagggggcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system