KEGG   Pseudomonas putida ND6: YSA_08153Help
Entry
YSA_08153         CDS       T02170                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppi  Pseudomonas putida ND6
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppi02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppi02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4399267..4400385
Genome map
AA seq 372 aa AA seqDB search
MFMAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEM
PMMDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKV
KQLLCEKVHTISRSNRRIGSYARTAPVATPAPASTFASQAQTRPAAPARAAAPTPAASQS
PAPKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLC
RISVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKS
YGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSL
DEIGKHLVEACI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatggcagtcaaggtcctggtggtggatgattctggtttcttccgccgccgtgtc
tcggaaatcctctcggcggatccaacgatccaggtagtgggtaccgcgaccaacggcaag
gaagcaatcgaccaggcgctggcgctcaagcccgatgtgatcaccatggactacgaaatg
cccatgatggatggcattaccgccgtgcggcacatcatgcagcgctgcccgacgcccgta
ttgatgttctcgtcgctgacccatgaaggcgcccgcgtcacccttgacgcgctggatgcc
ggcgcagtggactacctgccgaaaaacttcgaggacatctcgcgcaaccctgacaaggtc
aagcagttgctgtgcgagaaggtgcacaccatttcgcgcagcaaccgcaggatcggcagc
tatgccagaacggcgccggtcgccactccagcgccggccagcaccttcgccagccaggcg
cagacgcgcccggcagcgcctgcccgtgcagcggccccgacaccggcggcctcgcagtcg
ccggcacccaagcgcaaaccctacaaactggtggccatcggtacctccacgggggggccg
gtggcgctgcagcgggtactgacccagctgccggccaatttcccggcgccgatcgtgttg
atccagcacatgccggcggcgttcaccaaagcgtttgccgaacgcctggacaagctgtgc
cgcatcagcgtcaaggaagccgaagacggcgacatgctgcgcccgggcctggccctgctg
gcccccggtggcaagcagatgatgatcgatggccgtggcacggtgaagatcctgcccggc
gacgagcgcctgaactacaaaccgtgcgtggacatcaccttcgggtcggcggccaagtcg
tacggcgacaaggtgttgtcggtggtgctcaccggcatgggcgccgatggccgcgagggc
gcgcgcctgctcaagcaggggggcagcacggtgtgggcccaggatgaagccagctgcgtg
atttatggcatgcccatggccatcgtcaaggccaacctggcggatgccgtgtacagcctt
gacgaaatcggcaagcacctggtggaggcgtgcatctga

DBGET integrated database retrieval system