KEGG   Pseudomonas putida ND6: YSA_08308Help
Entry
YSA_08308         CDS       T02170                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ppi  Pseudomonas putida ND6
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YSA_08308
DNA repair and recombination proteins [BR:ppi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      YSA_08308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4475506..4476108
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLVASRIAHGVPLGGEL
EMVDGGTLAHAFAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctcatccgccaactgatcgacggcctgcgcatcttgccaggcgtt
ggccagaaaaccgcccagcgcatggccctgcaactgctcgagcgcgaccgcagtggcggg
ctgcgcctggctcaggccttgacccaggccatggaaggggtagggcattgccgccagtgt
cgcaccctcaccgagcaggaactgtgcccgcagtgcgccgacccgcgccgtgacgacacc
cagttgtgcgtggtcgaggggccgactgatgtgtatgcggtggagcagacgggctaccgt
ggccgttacttcgtgctcaaggggcacctgtcgccgctggatggcctggggcctgaggcg
atcggtattccgcagctgatggcgcggatcgaagagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacggtggagggggaggcgacggcgcattacattgcccagttgctg
agcgagaaaggcttggtggcgtctcgcattgcccatggtgtgccgctgggcggtgaactg
gagatggtggacggtggtaccttggcccatgcctttgcagggcgccggcccatttcgctc
tga

DBGET integrated database retrieval system