KEGG   Pseudomonas putida ND6: YSA_08442Help
Entry
YSA_08442         CDS       T02170                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppi  Pseudomonas putida ND6
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YSA_08442
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSA_08442
  Amino acid metabolism
   00310 Lysine degradation
    YSA_08442
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YSA_08442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4556560..4557783
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAASADAGEDDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAAPVVVAAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggcgactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaattgctgggttcgatcgttgaaggcggt
gctgccgccgcgcctgccgcggccgccgcaccagcagcggctccggccgctgccagcgct
gacgccggcgaagatgacccgatcgctgccccggctgcgcgcaagctggctgaagaaaac
ggcatcgacctggctaccgtggcaggcaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaacaagaagtcggctcctgccgctgcaccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtcgccgctggcgaccgtaccgagaagcgcgtg
ccgatgacccgcctgcgtgccaagatcgccgagcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcgcctgggcttcatgtcgttcttc
gtcaaggctgctaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggtaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggctgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtcgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tctcgcctgctgctggacatctaa

DBGET integrated database retrieval system