KEGG   Pseudomonas putida ND6: YSA_08442Help
Entry
YSA_08442         CDS       T02170                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00020  Citrate cycle (TCA cycle)
ppi00310  Lysine degradation
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSA_08442
  Amino acid metabolism
   00310 Lysine degradation
    YSA_08442
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YSA_08442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFK71337
UniProt: I3V0R6
Position
4556560..4557783
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVLEVLATADGVLGDIV
KGEGDTVLSDELLGSIVEGGAAAAPAAAAAPAAAPAAASADAGEDDPIAAPAARKLAEEN
GIDLATVAGTGKGGRVTKEDVVAAVANKKSAPAAAPAAKPAAAAAAPVVVAAGDRTEKRV
PMTRLRAKIAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGNDIVYHGFADVGVAVSSDRGLVVPVLRNAESMSLAEIENG
IATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPSRLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccaaccttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaagccgggcgaagccgtcaagcgtgacgagctgatcgtcgacatcgag
actgacaaggttgtcctggaagtactggcgactgccgatggcgtgctgggcgacatcgtc
aagggcgagggcgacaccgtcctgtccgacgaattgctgggttcgatcgttgaaggcggt
gctgccgccgcgcctgccgcggccgccgcaccagcagcggctccggccgctgccagcgct
gacgccggcgaagatgacccgatcgctgccccggctgcgcgcaagctggctgaagaaaac
ggcatcgacctggctaccgtggcaggcaccggtaaaggcggtcgcgtcaccaaggaagac
gtggttgctgctgttgccaacaagaagtcggctcctgccgctgcaccggctgccaagcct
gccgctgctgccgctgccccggttgtcgtcgccgctggcgaccgtaccgagaagcgcgtg
ccgatgacccgcctgcgtgccaagatcgccgagcgtctggtcgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagacccacaatggcgtgcgcctgggcttcatgtcgttcttc
gtcaaggctgctaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatcgacggc
aacgacatcgtctaccacggcttcgccgacgtcggtgttgccgtgtccagcgaccgtggc
ctggtggtgccggtgctgcgtaacgccgagtcgatgagcctggctgaaatcgagaacggc
atcgctaccttcggcaagaaggcccgtgacggcaaactgtccatcgaagagatgaccggt
ggtaccttcaccatcaccaacggtggcaccttcggttcgatgatgtcgaccccgatcgtc
aacccgccgcaggctgccattctcggcatgcacaacatcatccagcgcccgatggccatc
aatggccaggtcgtgattcgcccgatgatgtacctggcgctgtcgtacgatcaccgcctg
atcgacggcaaggaagcggtaaccttcctggtcactatcaagaacctgctggaagatccg
tctcgcctgctgctggacatctaa

DBGET integrated database retrieval system