KEGG   Pseudomonas putida ND6: YSA_08445Help
Entry
YSA_08445         CDS       T02170                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00020  Citrate cycle (TCA cycle)
ppi00640  Propanoate metabolism
ppi00660  C5-Branched dibasic acid metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSA_08445
   00640 Propanoate metabolism
    YSA_08445
   00660 C5-Branched dibasic acid metabolism
    YSA_08445
Enzymes [BR:ppi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YSA_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AFK71339
UniProt: I3V0R8
Position
4559485..4560651
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEQAAEACDKIGGNEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKNLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVQQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgaatacggcctgccagtttcc
aagggtttcgcagtcgacacccctgagcaagctgcagaagcctgcgacaagatcggcggg
aacgagtgggttgtaaaagcccaggttcacgcgggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgccaaggcgttcgctgcacagtggttgggcaagaat
ctggttacctaccagaccgatgccaacggtcaacccgtctccaagattctggtcgaatcc
tgcactgacatcgccaaagagctgtacctgggcgctgtagtcgatcgttcgagccgccgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtcgctcacgaaacg
cctgagaaaatcctcaaggccaccatcgacccactggtcggcgctcagccgttccagggt
cgcgagctggctttccagctgggcctggaaggcaagcaagttcaacagtttgccaagatc
ttcgttggcctggccaagctgttcaaggatcatgacctggcgctgctggaagtgaacccg
ctggtgatcaaggccgatggcgacctgcactgcctcgatgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccgaagctgaaaaccttccacgacccgtcgcaggacgacgcc
cgtgaagcccacgctgccaagttcgaactgaactacgttgcccttgaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatggggaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggtggtgctaccaaagagcgcgttaccgaa
gcgttcaagatcattctgtccgacagcaatgtcgcggccgttctggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcattggtgcagtgaaagaagtcggc
gttaaagttccggtcgtcgttcgcctcgaaggcaacaacgccgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcattgcggcaaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system