KEGG   Pseudomonas putida ND6: YSA_08612Help
Entry
YSA_08612         CDS       T02170                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00630  Glyoxylate and dicarboxylate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01200  Carbon metabolism
Module
ppi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YSA_08612
Enzymes [BR:ppi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YSA_08612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFK71425
UniProt: I3V104
Position
complement(4684974..4686299)
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVVGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcgcgtcagggcgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgccccgaaaaagatttcgtcaactgcatgggcgccctg
acgggcggccaggctgtacagcaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaaacgcatcaacaacgcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaagggtacatcgactacttcgcg
cccatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgccggcgtgcacttcgaagaccagctggcctcggtt
aaaaaatgcggccacatgggcggcaaggtgctggtgccgactcaggaagccgtacagaag
ctggtggccgctcgcctggccgctgacgtgtcgggtgtaccgaccatcattctggcccgc
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtggttggcgagcgcacccgcgaaggcttctacaaggtccgtgccggcctcgatcaggcc
attgcccgcggcctggcctatgccccgtacgccgacctgatctggtgtgaaaccgccaag
ccggacctggacgaagcccgccgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgaattgtcggccatgggttacaagcatcagttcatcaccctg
gctggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggcggcgcttcgtcggtgactgcactgaccggctcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system