KEGG   Pseudomonas putida ND6: YSA_08679Help
Entry
YSA_08679         CDS       T02170                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppi  Pseudomonas putida ND6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4725344..4727554
Genome map
AA seq 736 aa AA seqDB search
MNVTTRENGGLRQRDLDALARAEHADPFAVLGPHGDGAGGQVVRAFLPNALKVRVQARDD
GRVLAEMEQGSLPGLFSAHLDEAQPYQFHIVWAGGEQVTEDPYSFGPQLGDMDLHLFAEG
NHRDLSGRFGAQPTQVDGIDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHGAGVWE
LFIPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHAWQDHDWMAQ
RAQRHAYNAPLSIYELHPGSWRCELDEAGEVGRFYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWDHDSELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVASEAVASHGQPLS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttacaacgcgtgaaaacggtggccttcggcaacgggacctcgacgccctggcc
cgcgccgaacacgccgatccttttgcggtactcggcccccacggcgacggcgcaggcggg
caggtggtccgcgcctttctgcccaatgccctgaaagtgcgcgttcaggcccgggatgac
gggcgggtccttgccgaaatggagcagggcagcctacctgggttgttcagcgcgcacctt
gatgaggcacagccctaccagtttcatatcgtctgggccggtggcgaacaggttaccgaa
gacccctacagtttcggcccgcaactgggtgacatggaccttcacttgttcgcggaaggc
aatcaccgcgatttgtccgggcgcttcggtgcccagccgactcaggtcgatggcatcgac
ggcgtgtgtttctcggtctgggcgccgaatgcccggcgggtgtcggtggtaggtgatttc
aacaactgggatggtcgccgccaccccatgcgcctgcgccacggtgccggggtgtgggaa
ctgttcattccgcgtctgggcgtgggcgaaacctacaagttcgaagtgcttggcaaggac
ggcatactgccgctgaaggccgatccgctggcacgtgccaccgagctgccgccgagcacg
gcgtccaaggtagccggtgaactcagccacgcctggcaggaccatgactggatggcgcaa
cgcgcccagcgccatgcctacaacgcgccgttgtcgatctacgagctgcacccagggtca
tggcgctgcgagctggacgaagcgggcgaagtcgggcgtttctacaactggcgcgaactg
gccgagcggctggtgccctatgtgcaggaactgggctttacccatatcgaattgctgccg
atcatggaacacccgttcggcggctcctggggctatcaaccattgtcgatgttcgcgccc
acctcgcgctacggcagtgccgaggatttcgccgcgttcatcgacgcctgccaccaggga
ggcatcggtgtactgctggactgggtgccggcgcattttcccaccgacgaacatggcctg
gcgcgcttcgatggcactgcgctgtacgaatacgacaaccccctggagggctaccaccag
gactggaacacgctgatctacaacctcgggcgcaatgaagtgcgaggcttcatgatggct
tcggcgctgcactggttgaagcatttccacatcgacggcctgcgcgtcgatgcggtggcc
tcgatgctgtaccgcgactactcgcgcaaggctggcgaatgggtacccaaccgtcacggc
gggcgcgagaacctggaagccatcgacttcatccgccaccttaacggcgtggctgcccac
gaggccccgggtgcgctgatcatcgccgaagagtccaccgcctggcctggggtcagccag
cctacccaacagggcggcctgggttttgcctacaagtggaacatgggctggatgcacgac
accctgcactacatccagaacgacccggtgcaccgcacctaccaccacaacgagatgagt
ttcgggctgatctatgcctattccgagcacttcatcctgcccatttcccatgatgaggtg
gtgcacggcaagcattcgctgatcgacaagatgcccggcgaccgctggcagaagttcgcc
aacctgcgcgcctacctcaccttcatgtgggcacatccgggcaagaagctgctgttcatg
ggctgcgagttcggccagtggcgtgagtgggaccacgacagcgaactggactggtacctg
ctgcagtatcccgagcaccagggcgtgcagcgcctggtgggcgacctcaaccgcctgtac
cgcgaagtgccggcgctgcacgagcaggattgccagccgcagggcttccagtggctgatc
ggtgacgacgcgcaaaacagcgtgtacgcctggctgcgctggagcagcagcggcgagccg
gtgctggtggtggccaacttcaccccggtaccccgtgagggttaccgcattggcgtgccg
ttcggcgagcgttggcaggagctgctgaacagcgatgccgagctgtatgccgggtcgaac
gtgggtaatctgggggcggtggccagtgaggcagtggccagccacgggcagccattatcg
ctggccctgaacctgccgccgctgggggtgttgatcatgaagcccgcctga

DBGET integrated database retrieval system