KEGG   Pseudomonas putida ND6: YSA_08679Help
Entry
YSA_08679         CDS       T02170                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppi  Pseudomonas putida ND6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YSA_08679
Enzymes [BR:ppi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     YSA_08679
Exosome [BR:ppi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YSA_08679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4725344..4727554
Genome map
AA seq 736 aa AA seqDB search
MNVTTRENGGLRQRDLDALARAEHADPFAVLGPHGDGAGGQVVRAFLPNALKVRVQARDD
GRVLAEMEQGSLPGLFSAHLDEAQPYQFHIVWAGGEQVTEDPYSFGPQLGDMDLHLFAEG
NHRDLSGRFGAQPTQVDGIDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHGAGVWE
LFIPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGELSHAWQDHDWMAQ
RAQRHAYNAPLSIYELHPGSWRCELDEAGEVGRFYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSMFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWDHDSELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGAVASEAVASHGQPLS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttacaacgcgtgaaaacggtggccttcggcaacgggacctcgacgccctggcc
cgcgccgaacacgccgatccttttgcggtactcggcccccacggcgacggcgcaggcggg
caggtggtccgcgcctttctgcccaatgccctgaaagtgcgcgttcaggcccgggatgac
gggcgggtccttgccgaaatggagcagggcagcctacctgggttgttcagcgcgcacctt
gatgaggcacagccctaccagtttcatatcgtctgggccggtggcgaacaggttaccgaa
gacccctacagtttcggcccgcaactgggtgacatggaccttcacttgttcgcggaaggc
aatcaccgcgatttgtccgggcgcttcggtgcccagccgactcaggtcgatggcatcgac
ggcgtgtgtttctcggtctgggcgccgaatgcccggcgggtgtcggtggtaggtgatttc
aacaactgggatggtcgccgccaccccatgcgcctgcgccacggtgccggggtgtgggaa
ctgttcattccgcgtctgggcgtgggcgaaacctacaagttcgaagtgcttggcaaggac
ggcatactgccgctgaaggccgatccgctggcacgtgccaccgagctgccgccgagcacg
gcgtccaaggtagccggtgaactcagccacgcctggcaggaccatgactggatggcgcaa
cgcgcccagcgccatgcctacaacgcgccgttgtcgatctacgagctgcacccagggtca
tggcgctgcgagctggacgaagcgggcgaagtcgggcgtttctacaactggcgcgaactg
gccgagcggctggtgccctatgtgcaggaactgggctttacccatatcgaattgctgccg
atcatggaacacccgttcggcggctcctggggctatcaaccattgtcgatgttcgcgccc
acctcgcgctacggcagtgccgaggatttcgccgcgttcatcgacgcctgccaccaggga
ggcatcggtgtactgctggactgggtgccggcgcattttcccaccgacgaacatggcctg
gcgcgcttcgatggcactgcgctgtacgaatacgacaaccccctggagggctaccaccag
gactggaacacgctgatctacaacctcgggcgcaatgaagtgcgaggcttcatgatggct
tcggcgctgcactggttgaagcatttccacatcgacggcctgcgcgtcgatgcggtggcc
tcgatgctgtaccgcgactactcgcgcaaggctggcgaatgggtacccaaccgtcacggc
gggcgcgagaacctggaagccatcgacttcatccgccaccttaacggcgtggctgcccac
gaggccccgggtgcgctgatcatcgccgaagagtccaccgcctggcctggggtcagccag
cctacccaacagggcggcctgggttttgcctacaagtggaacatgggctggatgcacgac
accctgcactacatccagaacgacccggtgcaccgcacctaccaccacaacgagatgagt
ttcgggctgatctatgcctattccgagcacttcatcctgcccatttcccatgatgaggtg
gtgcacggcaagcattcgctgatcgacaagatgcccggcgaccgctggcagaagttcgcc
aacctgcgcgcctacctcaccttcatgtgggcacatccgggcaagaagctgctgttcatg
ggctgcgagttcggccagtggcgtgagtgggaccacgacagcgaactggactggtacctg
ctgcagtatcccgagcaccagggcgtgcagcgcctggtgggcgacctcaaccgcctgtac
cgcgaagtgccggcgctgcacgagcaggattgccagccgcagggcttccagtggctgatc
ggtgacgacgcgcaaaacagcgtgtacgcctggctgcgctggagcagcagcggcgagccg
gtgctggtggtggccaacttcaccccggtaccccgtgagggttaccgcattggcgtgccg
ttcggcgagcgttggcaggagctgctgaacagcgatgccgagctgtatgccgggtcgaac
gtgggtaatctgggggcggtggccagtgaggcagtggccagccacgggcagccattatcg
ctggccctgaacctgccgccgctgggggtgttgatcatgaagcccgcctga

DBGET integrated database retrieval system