KEGG   Pseudomonas putida ND6: YSA_08693Help
Entry
YSA_08693         CDS       T02170                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppi  Pseudomonas putida ND6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YSA_08693
Enzymes [BR:ppi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YSA_08693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4735314..4737383)
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLATSVGLNRDWIDANARPQRVSDDVLRNVLEGLGHPAGDDAAVAASLRAVET
AEDSEHLPPLLTADLGQPLALARYFSAASVAHCTLEDHTSVTLSLDDQARLPGELPIGYH
QVEIDSRRFTVAVAPTRCHSLEDKVQQPPPRYWGLAVQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYTSPAALLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGDHPLRTDFDSFREAGGQTLEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEALANAYPAKVEFHAFCQWLTERGL
QRAHEAARSNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLSVGAPPDILNHVGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLDYPL
DDLLRLLALESVRHQAIILGEDLGTVPDSLREKLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLANRDIDWRHRLQLIDAAAELHWRHERQKERDGLRRILEA
NYGELKDNDALIDAAIRFVGHTRAPLVLVPLEDLLGCDEQPNLPGTTNGHPNWRRRFALP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcaaccagcgtcgggctgaaccgcgactggatt
gacgccaatgccaggccccagcgtgtcagcgacgacgtgctgcgcaacgtcctcgaaggc
cttggccacccggccggcgatgacgcggccgttgccgccagcctgcgtgcggtggaaacc
gccgaagacagcgaacacctgccgcctttgctgaccgccgacctaggccagccgctagcg
ctggcgcgctacttcagtgccgccagcgtggcccactgcaccctggaagatcacacctcg
gtcaccctcagcctcgatgaccaggcgcgcctgcccggcgagctgcccatcggctatcac
caggtggaaatcgacagccgccgcttcaccgtggcggtggcgccaacacgctgccacagc
ctggaagacaaggtgcaacagccgccaccacgctactggggcctggcagtgcagctgtac
agcctgcgccgccccggcgatggtggctacggcgactgcctggcgctggagcagttggcc
cgctcggccgccgagcgcggcgccgatgccttggctatcagcccgattcacgccctgtcg
gccatcgaccaggaacactacagcccctactcaccttccagtcgcctgctgctcaacacc
ctgtacaccagccccgcagccctgctgggtgaacgggaggtgcgcatggccatcgaagcc
tgcgggctggagcaacaactcgaagagctggagcagcgccctctggtcgactggccacgc
gccgccagcgctcggctgcgtttgcttgaagcgctttaccaaggcttcagccaaggcgac
cacccactacgcactgattttgacagcttccgcgaagccggcggccagaccctggagcac
cactgccgcttcgaggtgctgcaggcccaggcggtggagcacggcctcggtgccgactgg
cgcaactggcccaaagcctggcatgacccctaccacccggaagtggaggctttagccaat
gcctacccggccaaggtcgagttccacgcgttctgccagtggctgaccgaacgtggcctg
caacgtgcccacgaagcggcccgcagcaacggcatggccgtgggcctgatcgccgacctg
gcggtgggtgccgacggtgccggcagccaggcctggagccgtcaggacgaactgctggcc
ggcctgagcgtgggtgcgccgcctgacatcctcaaccacgtcgggcaggactggggcatt
tgcgccttctcgcccgagggcctcaagcgcaatggctatcgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctatggctgatcccacagggggccaaacccagcgaaggcgcctacctcgattacccgtta
gacgacctgttgcgcctgctggcgctggagtcggtgcgtcaccaggcgatcatcctcggc
gaagacctgggcaccgtgcccgacagcctgcgtgaaaagctggccgagaaggcggtgctg
ggcatgcgcgtgctgccgttcgagcagacccagccgggccagttcaagccgattctcgac
tggccagacaatgccctggccacaaccggcacccacgacctggcgccactggccggctgg
ctagcaaaccgcgacatcgactggagacaccgcttgcaactgattgatgctgctgccgaa
ttgcactggcgacacgagcgtcagaaagaacgcgacggcctgcgccgcatcctggaggcc
aactacggcgaactgaaggacaacgacgcgctgatcgatgcggccatccgcttcgttggc
catacccgtgcgccgctggtgctggtaccgctggaagacctgctgggttgcgacgagcaa
cccaacctgccgggtaccaccaatggccatcccaactggcgacggcgctttgcccttcca
gtacgcgaactgctcgacgatgaggacgccgcacggcgcctggagctgctggcccaggcc
cgcgaacaggcgtgggagcgcgaccgatga

DBGET integrated database retrieval system