KEGG   Pseudomonas putida ND6: YSA_09230Help
Entry
YSA_09230         CDS       T02170                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YSA_09230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YSA_09230
  Lipid metabolism
   00071 Fatty acid degradation
    YSA_09230
  Amino acid metabolism
   00350 Tyrosine metabolism
    YSA_09230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YSA_09230
   00626 Naphthalene degradation
    YSA_09230
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YSA_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4963162..4964172)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRHVDVVEKTLRPLEYGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWVAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcacgtggacgtggtagagaaaaccctgcgc
cctctcgaatacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtgaaaaatggcgactttggtgacaagaccggtgtagtactgggccacgaaggt
attggcgtggttcaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgtgcc
agcgtcgcctggttctaccagggttgcggacattgcgaatactgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggttacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgctgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagttaagatctccaacgtccgc
cccggccaatgggtcgcgatctacggcctcggcggcctgggcaacctggccctgcaatat
gccaagaatgtgttcaacgccaaagtcatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggacctggtggtcaacccgctcaacgaagatgccgcgaag
gtcatccaggctaaaaccggcggtgcacatgctgccgtcgttactgctgtggccaaaggc
gcgttcaactcggctgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattccccgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgaggatatcaaccagatctttgacgag
atgcttgagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system