KEGG   Pseudomonas putida ND6: YSA_09267Help
Entry
YSA_09267         CDS       T02170                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppi  Pseudomonas putida ND6
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YSA_09267
   00052 Galactose metabolism
    YSA_09267
   00500 Starch and sucrose metabolism
    YSA_09267
   00520 Amino sugar and nucleotide sugar metabolism
    YSA_09267
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YSA_09267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4977046..4977885
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYKQYRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIANTKPGKGGEIQITDALLQQAKD
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcttgttcccggcagccggctacggcacacgcttcttgcctgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaagcattggatgcgggtctgaacgagatctccatcgttaccgggcgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtattcgtcgtctgctcaacgagtgctcgttctcgtacacg
cgccagaccgaaatgaagggcctcggccacgccattctcactggccgcccactgatcggc
gacgagccgttcgcggtggtgctggcggacgacctgtgcgttaacccggaaggtgacggc
gtgctgactcagatggtcaagctgtacaaacagtaccgctgctcgatcgtcgccatccag
gaagtcgacccgcaggaaaccaacaagtatggtgtgatcgccggtgagatgatccgcgac
gacatcttccgtgtgaccaacatggtcgaaaaaccggccccggaagacgcgccttcgaac
ctggcgatcattggccgttacatcctgaccccggatatcttcgacatcatcgccaatacc
aagccaggcaaaggcggtgaaatccagatcactgatgccctgttgcagcaggcgaaggat
ggctgcgtgattgcctacaagttcaagggcaagcgtttcgactgcggtggcgccgaaggc
tacatcgacgcgaccaacttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system