KEGG   Pseudomonas putida ND6: YSA_10129Help
Entry
YSA_10129         CDS       T02170                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppi  Pseudomonas putida ND6
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5434428..5435426
Genome map
AA seq 332 aa AA seqDB search
MSARTTCRYRSALHLQRLRRCLGLWVLLVLSGGSGAEPLDEPLKPLPPIPTLTPGRVELG
RQLFNDPRLSRNGTRSCASCHRLDKYGADDRAFSMGADGLPLTLNTPTVLNASLNFRQFW
NGRVESLEEQGEAVITSAHEMGGDWRVIEQRIAADVHYRQAFKDAYPDAVTKDNILSALA
DYQRTLLTPGARFDRYLQGDTEALTLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVF
GDYIADRGHPTEADQGRFNVTGEEADRGVFKVPSLRNVAVTAPYFHDGSAPTLERAIDVM
FQYQLGRIPSDEDRRLIMLFLKTLTAEKVGQP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcgcacaacctgtcgttatcgttccgctcttcacctgcagcgcttgcgccgt
tgtctgggcctgtgggtgctgctcgttctgagcggaggcagcggggcggagccgctggac
gagccgctcaagccgctgcctccgatacccactctgacacctgggcgtgtcgagttgggc
cgccagttgttcaacgatccgcggttgtcgcgcaacggcacacggtcctgcgccagctgt
caccgtctggacaagtacggggccgatgaccgggcgttttccatgggggcagatggcctg
ccgcttacgctcaatacgccaacggtactcaatgccagccttaatttccgacagttctgg
aatggccgggtcgagtcactcgaggagcagggggaggccgtgatcaccagcgctcacgag
atgggcggagactggcgcgtgatcgagcagcgcatcgccgcagacgtgcattaccgccag
gcgttcaaggatgcctacccggacgcggtgacaaaggacaacatcctcagcgcgttggcc
gattaccaaaggacgcttcttacccctggcgcgcgcttcgatcgttacctgcagggcgat
accgaggcgcttaccctggaggaaaaatacggctaccagcgcttcaaggactatggctgc
atcgcctgccaccaaggggtgaatattgggggcaacatgttccagaaatttggcgtgttc
ggcgactacatcgcggaccgcggccaccctaccgaggcggatcagggccgcttcaacgtg
accggagaggaggccgaccggggcgtgttcaaagtgccgagcctgcgcaatgtggcggtg
accgcgccctattttcacgatggctcggcgcctacgctggagcgtgcgattgacgtgatg
tttcagtatcagcttggacgaatcccaagtgatgaggaccgcaggctcatcatgctgttc
ctcaaaacccttactgctgaaaaggtgggtcagccatga

DBGET integrated database retrieval system