KEGG   Pseudomonas putida ND6: YSA_10797Help
Entry
YSA_10797         CDS       T02170                                 

Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00071  Fatty acid degradation
ppi00280  Valine, leucine and isoleucine degradation
ppi00281  Geraniol degradation
ppi00310  Lysine degradation
ppi00360  Phenylalanine metabolism
ppi00362  Benzoate degradation
ppi00380  Tryptophan metabolism
ppi00410  beta-Alanine metabolism
ppi00627  Aminobenzoate degradation
ppi00640  Propanoate metabolism
ppi00650  Butanoate metabolism
ppi00903  Limonene and pinene degradation
ppi00930  Caprolactam degradation
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01212  Fatty acid metabolism
Module
ppi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YSA_10797
   00650 Butanoate metabolism
    YSA_10797
  Lipid metabolism
   00071 Fatty acid degradation
    YSA_10797
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YSA_10797
   00310 Lysine degradation
    YSA_10797
   00360 Phenylalanine metabolism
    YSA_10797
   00380 Tryptophan metabolism
    YSA_10797
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YSA_10797
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YSA_10797
   00281 Geraniol degradation
    YSA_10797
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YSA_10797
   00627 Aminobenzoate degradation
    YSA_10797
   00930 Caprolactam degradation
    YSA_10797
Enzymes [BR:ppi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YSA_10797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFK72622
UniProt: I3V4F1
Position
complement(5775589..5776383)
Genome map
AA seq 264 aa AA seqDB search
MQPEEPDMPRYIDVQAPEHGVQLITLQRPEALNALCTELLAELAAALQAAGDDEHVRATV
ITGSGKAFAAGADIREMADRDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELA
MCADIVIAGTDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAHRAQQA
GLVSEITQPELTVERAMQVARSIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLL
AGTADRDEGIRAFQEKRQARFQGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccagaggaacccgacatgccgcgatatatcgacgtgcaggcgcccgaacatggc
gttcagctcattaccctgcaacggcccgaggccttgaatgccctgtgcaccgagctactg
gcagaactggctgctgcgctgcaggctgccggggacgacgagcatgtccgggccacagtg
attaccggcagtggcaaagctttcgccgcaggcgccgacatccgcgagatggctgatcgc
gacctggtcggcatcctcaatgacccgcgcgtagcgcattggcaaagcatcgccgcattc
gccaaaccgctgattgccgcagtcaacggctatgccctgggtggcggctgcgaactggca
atgtgcgccgacatcgtcatcgccgggaccgacgcccgtttcggccagccggaaatcaac
cttggcatcatccccggtgctggcggcacccagcgcctgttgcgtgccgtcggtaagccg
ttggccatgcagatggtactgacgggggaagccatcactgcccaccgcgcccagcaggcc
ggcctggtcagcgaaatcacccagcccgaactcaccgtagaacgcgccatgcaggttgcc
cgcagcatcgccgccaaagcgccgctggccgtgcgcctggccaaggaggcgttactgaag
gccggtgataccgacctggccagcggcctacgcttcgagcgccatgccttcaccctgctg
gctggcaccgccgaccgcgatgaaggcatccgcgccttccaggaaaagcgccaagcccgt
ttccaggggcgctga

DBGET integrated database retrieval system