KEGG   Pandoraea pnomenusa 3kgm: U875_04375Help
Entry
U875_04375        CDS       T02936                                 

Definition
aminotransferase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    U875_04375
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    U875_04375
Enzymes [BR:ppk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     U875_04375
Lipid biosynthesis proteins [BR:ppk01004]
 Desaturase
  First
   U875_04375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
933287..934483
Genome map
AA seq 398 aa AA seqDB search
MLDSLLGFLSTGLLDWSGWEITLFTLAVTHVTIAAVTIYLHRCQAHRALDVHPIVSHFFR
FWLWMTTGMVTSEWAAIHRKHHAKCETPEDPHSPQTRGLWKVLAEGAELYRAEAKNEETL
RKFSHGTPNDWIENHVYKRYPILGISFMMIIDIALFGAIGLTVWAVQMVWIPFWAAGVVN
GLGHYWGYRNFNCADASTNLLPWGIIIGGEELHNNHHTYATSAKLSNKWYEFDIGWMYIR
MMQAVGLAKVKKIAPTPKLAKNKAACDDDTLQAVLSNRYEVMARYAKTFKRAYGEELARF
KEKRQHGEYQLFRGARKWLHHDEASLQEPQKQQLGEIFAHSNAVKTYYELRNELAGIWER
SNASREQLLSQLQNWCQRAEQSGIHALQEFASRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgctggacagtcttcttggatttctctcgaccggcctgctcgactggagcggctgggag
atcacgttgttcacgctggccgttacccatgtaacgattgccgccgtgacgatctacctg
caccgttgccaggcgcaccgcgcgctcgacgtgcatccgatcgtctcccatttcttccgt
ttctggctgtggatgaccaccgggatggtcaccagcgagtgggcggcgattcaccgcaag
caccacgccaagtgcgagacgcctgaagatccgcacagcccgcaaacgcgtggtctgtgg
aaggtgctggccgaaggcgccgagctctatcgcgccgaagcgaagaacgaggaaacgctg
cgcaagttcagccacggcacgccgaacgactggatcgagaaccatgtctacaagcgctat
ccgatcctgggcatcagcttcatgatgatcatcgacatcgcgctgttcggtgccatcggt
ctgaccgtgtgggccgtgcagatggtgtggatcccgttctgggccgccggtgtcgtcaat
ggtctgggccactactggggctaccgcaacttcaactgcgccgacgcgtcgacgaacctg
ctgccgtggggcatcatcatcggcggtgaggaactgcacaacaatcaccacacctacgcc
acgtcggccaagctgtcgaacaagtggtacgagttcgatatcggctggatgtacatccgc
atgatgcaggcggtggggctggccaaggtgaagaagatcgcgccgacgcccaagctcgcg
aagaacaaggcggcgtgcgacgacgacacgctgcaggccgtgctctcgaaccgctatgaa
gtgatggcgcgctatgccaagaccttcaagcgggcctacggagaggagctggcgcgcttc
aaggagaagcgccagcacggcgagtaccagttgttccgcggtgcacgcaagtggctgcat
cacgacgaagcctcgctgcaggagccgcagaagcagcaactcggcgagatcttcgcgcac
agcaatgcggtgaagacgtactacgaactgcgcaatgaactggccggtatctgggagcgt
tcgaacgcatcgcgcgagcagttgctgagccagctgcagaactggtgccaacgcgccgag
caaagcggaattcatgcgttgcaggaattcgcttcgcgcctgcgtcgctacgcctga

DBGET integrated database retrieval system