KEGG   Pandoraea pnomenusa 3kgm: U875_11720Help
Entry
U875_11720        CDS       T02936                                 

Definition
(GenBank) thymidine phosphorylase (EC:2.4.2.4)
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    U875_11720
Enzymes [BR:ppk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     U875_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2557098..2558600)
Genome map
AA seq 500 aa AA seqDB search
MTGRRLRARRMQVDTLREAVAYLRRDSLICRSEGFAAQTRLQLDFRDVTVVATLQTVIGD
WLELDEIGLSEAALLALEVDEGEWVRVRHMPPVESFRHVRGRMFGEAFTPAALDEVIGDI
AAGRYSSIHISAFLTACTGNRLDDDEIIALTRAMVATGKTLQWQADTVIDKHSIGGLPGN
RTTPIVVAIVTSQGLVMPKTSSRAITSPAGTADTMETLAPVDLSAQEMRQVVDKVGGCIV
FGGAAGLSPADDILIQVERPLDLDSEAQMMASILSKKLAVGATHALIDIPVGETAKIRTR
YASALFSERLRAIGRALGLEIDTYVCQGEQPVGRGIGPSLEARDVLAVLQNLSRAPSDLM
NKSLEISGRLLEIGGKALPGDGLASARRTLTSGLAWQQFQRICEAQGGMREPVVGRHSRP
VTARHNGTVTAVDNRHLSRVAKLAGAPTAARAGVVYEAPIGAMVATGQPLFTIYAESRGE
LEYAFEYACRFPGIVAVRES
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ctgaccggacgccgcctgcgtgcgagacgcatgcaggtcgatacgctgcgcgaagcggtg
gcgtaccttcgtcgcgacagcctgatctgtcgctccgaaggatttgcggcccagacccgc
ctgcaactggatttccgcgacgtgaccgtcgttgccacgcttcagacggtcatcggcgac
tggctggagctcgacgaaatcggtttgagcgaggcggccctgctggcattggaagtggac
gaaggcgaatgggttcgggtgcggcatatgccaccggtcgaatcgtttcggcacgtccgg
ggccggatgttcggcgaggcgttcacccccgccgcacttgacgaagtgatcggcgatatt
gcggcgggccgttactcgtcgattcacatttccgcgtttttgaccgcctgcaccggcaac
cggctcgacgacgacgagatcatcgcgctcacgcgcgcgatggtggccaccggaaaaacg
ctgcaatggcaagccgatacggtcatagacaaacacagcatcggcggactgcctggcaac
cggacgaccccgatcgtcgtggcgatcgtgacctcgcagggactggtcatgcccaagaca
tcgtctcgcgccatcacttcgcccgccggcacggccgatacgatggagacgctcgcgcca
gtcgacctcagcgcgcaggagatgcgccaggtcgtcgacaaggtggggggctgcatcgtg
ttcgggggcgccgcgggcctgagtcccgccgacgacattctgattcaggtggagcgcccg
ctcgatctcgacagcgaggcccagatgatggcgtcgatcctgtcgaagaagctggctgtg
ggcgcgacccatgccctgatcgacattccggtcggcgagaccgcgaaaatccgcacgcgt
tacgcgagcgcgctcttttccgagcgcctgcgcgcgatcggccgcgccctggggctcgag
atcgacacctacgtctgtcagggcgaacaaccggtcggccggggcatcgggccgagcctc
gaggcacgcgatgtgctcgcggtgcttcagaacctcagccgtgcgccgtccgacttgatg
aacaagagcctcgagatttccggccgattgctcgaaatcggcggcaaggccctacccggc
gacggactggccagcgcccgtcgcacgctgaccagcgggctcgcctggcagcagtttcag
cggatctgcgaagcgcagggcggcatgcgtgagccggtcgtcggacgccacagccggccg
gtgaccgctcgacacaacggtaccgtcaccgccgtcgacaaccggcatctgtcgcgcgtg
gcaaagctcgccggcgcgccgacagccgcgcgcgccggggtcgtctacgaggcgccgatc
ggcgccatggtcgcaaccggccagccgctcttcaccatttacgccgaaagccgtggcgag
ctcgaatacgcattcgaatacgcctgccgcttccccggcattgtcgcagtgagggaatca
tga

DBGET integrated database retrieval system