KEGG   Pandoraea pnomenusa 3kgm: U875_13280Help
Entry
U875_13280        CDS       T02936                                 

Definition
(GenBank) aminotransferase
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    U875_13280
   01230 Biosynthesis of amino acids
    U875_13280
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U875_13280
   00290 Valine, leucine and isoleucine biosynthesis
    U875_13280
   00220 Arginine biosynthesis
    U875_13280
Enzymes [BR:ppk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     U875_13280
    2.6.1.66  valine---pyruvate transaminase
     U875_13280
Amino acid related enzymes [BR:ppk01007]
 Aminotransferase (transaminase)
  Class I
   U875_13280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2904484..2905710)
Genome map
AA seq 408 aa AA seqDB search
MKPILKSQKLQNVCYDIRGPVLEHAKRMEDEGHRIIKLNIGNLAPFGFEPPDEIVQDMIR
NLPNSAGYSDSRGVFAARKAIMHYCQQKRIKDVQLDDIYLGNGASELIVMAMQALLNDGD
EVLVPAPDYPLWTAAVSLSGGTPVHYVCDEQADWQPDLADIRKKITPNTRAIVIINPNNP
TGALYSDELLKEIVALAREHKLIIYADEIYDKIIYDGAEHTSIASLSEDVLTITFNGLSK
SYRACGYRAGWMIVSGDKRPARDYIEGLNILASMRLCPNVPGQYAIQTALGGYQSIQDLI
VPGGRLYEQREIAHRMLTAIPGVTCVKPKAALYLFPRLDPAVYPIANDQEFILQLLLEEK
VLLVQGSGFNWMHPDHFRVVFLPHEGDLEDAISRIARFLDGYRRRHGK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgatcctcaaatcgcagaaattgcagaatgtctgctatgacattcgtgggccc
gtgctcgaacatgccaagcgcatggaagacgaaggtcatcgcatcatcaagctgaacatc
ggcaatctggcgccgttcggcttcgagccgcccgacgagatcgtgcaggacatgatccgc
aacctgccgaattcggccggctattcggactcgcggggcgtgttcgcggcgcgcaaggcg
atcatgcattactgtcagcaaaagcgcatcaaggatgtgcagctcgacgacatctacctc
ggcaacggggcgtcggagctcatcgtgatggccatgcaggcactgctcaacgatggcgac
gaggtcctcgtgcccgcgcccgactatccgctgtggacggcggcggtcagcctctcgggc
ggcaccccggtccactacgtctgcgacgaacaggcggactggcagcccgacctcgcggac
attcggaaaaagatcacgccgaacacgcgcgccatcgtcatcatcaacccgaacaacccg
accggcgcgctttactccgacgaactgctcaaggagatcgtcgcgctcgcacgcgagcac
aagctcatcatttacgccgacgagatctacgacaagatcatctacgacggcgccgagcat
acgtcgatcgcctcgctgtccgaggacgtgctcaccattactttcaacggcctgtcgaaa
agctatcgcgcgtgcggttaccgggcgggctggatgatcgtgtccggcgacaagcgcccg
gcgcgcgactatatcgaagggctgaacatcctggcctcgatgcggctgtgccccaacgtg
ccggggcagtacgccatccagacggcgctgggcggctaccagagcattcaggacctgatc
gtgccgggcgggcgcctgtacgagcagcgcgaaatcgcgcaccgcatgctcaccgctatt
cccggcgtgacctgcgtgaagccgaaggcggcgctttacctgttcccgcgtctcgatccg
gcggtgtaccccatcgccaacgaccaggaattcatcctccagttgctgctcgaagaaaag
gtcctgctggtgcagggcagcggtttcaactggatgcaccccgaccatttccgtgtcgtg
ttcctgcctcacgagggcgacctggaagacgccatcagtcgcattgcccgcttccttgac
ggttatcgccgtcgccacggcaagtga

DBGET integrated database retrieval system