KEGG   Pandoraea pnomenusa 3kgm: U875_16690Help
Entry
U875_16690        CDS       T02936                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
ppk  Pandoraea pnomenusa 3kgm
Brite
Enzymes [BR:ppk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     U875_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3604708..3605577)
Genome map
AA seq 289 aa AA seqDB search
MFQEDIFYKGGEHAVLLLPGLSSTPLEMRPVAKALQRDGYTVSVPHIAGYGLGSPCTDWR
AWIEAARAKFRALRETHETVSICGLSMGATLSLAVAQAEPDVTALSLLAVTLVYDGWTIP
WYYPLIDLVFHTPLRHRYRYQEKAPYGLKNEALRARVAKSMSLHDASEIGSASLPLAHLY
NARRLAAHVRARLERVTADCLIVHAVDDDTASPHNARIVYDGVSSEVKQKCLLGESYHIL
TMDNERETVADETRRFFRDAIARHTGTASPETRIISKALLRAKRRQAVA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgttccaggaagatatcttctacaagggcggtgagcacgccgtactgctgttgccgggg
ctctccagcacgccgctcgagatgcgtccggtggccaaggcgttgcagcgtgatggctat
accgtatcggtgccgcatattgccggttacggactcggctcgccgtgcacggactggcgc
gcctggatcgaagccgcccgcgcgaagtttcgcgcgctgcgtgagacgcacgagacggta
tcgatctgcggtctgagcatgggggccacgctgagcctggcggtcgcgcaggcggagccg
gacgtgacggcgctgtcgctgctggccgtcacgctggtgtatgacggctggaccatcccc
tggtattacccgctcatcgatctggtgtttcacacgccgctgcgccatcgctatcgctat
caggaaaaggcgccgtacgggctgaagaacgaggccctgcgcgcgcgcgtcgcgaagtcg
atgtcgttgcacgacgcctccgagatcggatcggcctcgttgcccctcgcgcatctctac
aacgcgcggcggcttgccgcgcacgttcgtgcgcgcctcgaacgcgtgacggcggactgt
ctgatcgtgcacgcggtcgacgacgatacggccagcccgcacaatgcgcgcatcgtgtac
gacggcgtgtcgtccgaagtgaagcagaagtgcctgctcggcgagagttatcacatcctc
acgatggacaacgagcgcgagaccgtggcggacgaaacacgtcggttcttccgcgacgcc
attgcccggcacaccgggaccgcgagcccggagacccgcatcatttccaaggcgctgctg
cgcgccaaacgccgtcaggccgtggcctga

DBGET integrated database retrieval system