KEGG   Pandoraea pnomenusa: U875_18470Help
Entry
U875_18470        CDS       T02936                                 

Definition
ribulose bisphosphate carboxylase
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ppk  Pandoraea pnomenusa
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppk01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppk00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4024721..4026013)
Genome map
AA seq 430 aa AA seqDB search
MNRTLSATYLIETPLDPERVAEVMAGEQSCGTFTRVAGETDALRARARATVESVERVGEV
SRASLPNAFLDRLAAKDPRAGHGPWHRARVRIAFPCDNVGANLPTLAATLAGNLYDLGEV
TGMRLERVAMPLAYRRQFEFPRYGIEGTRRATGVAQGALVGTILKPNVGMRADETAALVS
RLCDAGVDFIKDDEVCANPVHAPLTERVPAVMAAVRAHRERTGKQVMVAFNITDETGEML
RHADLVQREGGNCVMVSLNWCGFSAVTTLRRHTPLAIHGHRNGYGAMSRDPMLGIGFQAY
QALWRLAGVDHMHVHGLQGKFAQPDDEVIESALDCYAPLCVDAGDGPDDRVMPAFSSGQW
AGTVPATWQALGRDDLLFMAGGGILAHPDGAGAGVQSLRDAWQAMRAGQSLDEAARHAPA
LAAAMRFFGR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacgctgagtgcgacatacctgatcgagacgccgctcgatccggagcgggtc
gccgaagtcatggccggcgagcagtcttgcggcaccttcacccgggtggcgggcgagacg
gacgcgttgcgagcccgtgcccgcgccacggttgaatccgtcgagcgggtgggcgaggtc
tcgcgcgcatcgttaccgaacgcctttctcgatcgtctggccgcgaaagacccgagggcg
ggccatggaccgtggcatcgtgcacgggtgcgcatcgcgtttccgtgcgacaacgtgggc
gcgaatctgcccacgctggccgccacgttggcaggcaacctgtacgacctgggggaagtc
accggcatgcgcctggagcgcgttgcgatgcccctggcctatcgtcggcaattcgaattc
cctcgctacggcatcgaaggtacgcgccgggccacgggcgtggcacagggcgcgctcgtt
ggcacgatcctcaaacccaacgtgggcatgcgcgccgacgagacggccgcgctcgtctcg
cgcctgtgcgacgcgggcgtcgacttcatcaaggacgacgaggtctgcgccaaccccgtg
catgcaccgttgaccgaacgcgtaccggcggtcatggcggcggtgcgcgcgcatcgcgaa
cgcacgggcaagcaagtgatggtggccttcaacatcacggacgagaccggcgagatgttg
cgccacgccgacctcgtgcaacgcgagggaggcaattgcgtgatggtcagtctgaactgg
tgcggcttttctgccgtgacgacgctgcgtcggcatacgccgctggcgatccacggccat
cggaacggctacggcgccatgtcgcgcgacccgatgctgggcatcggcttccaggcctat
caggcgctctggcggctcgcgggcgtggatcacatgcacgtgcacggtctgcaaggcaaa
ttcgcgcagcccgatgacgaggtcatcgaatccgcgcttgattgctatgccccgctttgc
gtcgatgcgggcgacggcccggacgatcgcgtcatgcccgctttttcttccggtcagtgg
gccggcacggtgcccgcgacctggcaggcgcttgggcgcgacgacctgctcttcatggcg
ggaggcggcattctcgcgcatcccgacggggcgggcgccggcgtgcagagcctgcgcgac
gcgtggcaggcgatgcgcgccgggcagtcgctcgatgaagcggcacgccatgcgcccgcg
ctggccgccgccatgcgcttcttcgggcgctga

DBGET integrated database retrieval system