KEGG   Pandoraea pnomenusa 3kgm: U875_23095Help
Entry
U875_23095        CDS       T02936                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00071  Fatty acid degradation
ppk00072  Synthesis and degradation of ketone bodies
ppk00280  Valine, leucine and isoleucine degradation
ppk00310  Lysine degradation
ppk00362  Benzoate degradation
ppk00380  Tryptophan metabolism
ppk00620  Pyruvate metabolism
ppk00630  Glyoxylate and dicarboxylate metabolism
ppk00640  Propanoate metabolism
ppk00650  Butanoate metabolism
ppk00900  Terpenoid backbone biosynthesis
ppk01100  Metabolic pathways
ppk01110  Biosynthesis of secondary metabolites
ppk01120  Microbial metabolism in diverse environments
ppk01130  Biosynthesis of antibiotics
ppk01200  Carbon metabolism
ppk01212  Fatty acid metabolism
ppk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    U875_23095
   00630 Glyoxylate and dicarboxylate metabolism
    U875_23095
   00640 Propanoate metabolism
    U875_23095
   00650 Butanoate metabolism
    U875_23095
  Lipid metabolism
   00071 Fatty acid degradation
    U875_23095
   00072 Synthesis and degradation of ketone bodies
    U875_23095
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U875_23095
   00310 Lysine degradation
    U875_23095
   00380 Tryptophan metabolism
    U875_23095
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U875_23095
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U875_23095
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    U875_23095
Enzymes [BR:ppk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U875_23095
Exosome [BR:ppk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U875_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHB07878
UniProt: V5PX62
Position
5013448..5014632
Genome map
AA seq 394 aa AA seqDB search
MDNDVVILGAVRTPIGEFGGSLRHKPPAELGACVVRALLTRTGVSGEDVEQTVFGNVHQT
APADMYLGRVAALGGGIAPHAGALTVNRLCGSGLEAVLLAAHFIQSGEAQAAVGGGAETM
SLAPYLLPAHRFGAHPGDVVAADTLMGGLTDPMTGAHMGELGERIAARFDISRAQQDAIA
LASHQRAARAMASGYFDEQTVPVDVGSPGKPATFARDERVRAAAHADDFAKLKPAFRRND
GTITAANASGINDGAAAVLLASRERARALGRHPMARLIAHARVGVMPEDMGIGPVIATRE
VLRRAELRMNQMDVIELNEAFASIVGAFLREMALDASRVNPNGGAVALGHPVGATGAVMV
TKAVHELRRTGGRYALVTTCIGGGQGIAAIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgacgtggtcattctcggggcggttcgcacccccattggcgagttcggcggc
agcctgcgacacaaaccgcccgccgagctcggcgcatgcgtcgtgcgtgcgctgctcacg
cgcacgggcgtctccggcgaggacgtcgagcagacggtcttcggcaacgtgcatcagacg
gcgccggccgacatgtacctcggccgcgtggcggccctcggcggcggcatcgcgccgcat
gcgggggcgctcacggtcaatcgtctgtgcggctcggggctcgaagccgttctgctcgcc
gcgcatttcatccagtcgggcgaggcacaagccgccgtgggcggcggcgccgagacgatg
agtctggcgccgtacctgctgcccgcgcaccgcttcggcgcgcatccgggcgacgtcgtc
gcggccgacacgctgatgggcggactgaccgatccgatgaccggtgcgcacatgggagag
ctgggcgagcgcatcgctgcgcgcttcgacatcagccgcgcgcaacaggacgccatcgca
ctcgcctcgcatcaacgggccgcgcgcgccatggcctccggatacttcgacgaacagacg
gtgccggtggacgtcggctcaccgggcaagccggccacgttcgcgcgcgacgagcgcgtg
cgcgccgccgcgcacgcagacgatttcgcgaagctcaaaccggccttccgtcgcaatgac
ggcaccatcaccgcggcgaacgcctcgggcatcaacgacggcgccgccgccgtcctgctc
gcaagccgtgagcgcgcgcgcgcactcggtcggcacccgatggcgcgtctgatcgcccac
gcgcgcgtgggtgtgatgccggaggacatgggcatcggcccggtgatcgccacgcgcgag
gtgcttcggcgcgccgagcttcggatgaatcagatggacgtgatcgagctcaacgaagcg
ttcgcctcgatcgtcggtgcgttcctgcgggagatggcgctggacgcgtcccgcgtcaat
ccgaacgggggcgccgttgcgctggggcatccggtcggggcgaccggtgcggtgatggtg
acgaaggccgtgcacgaactgcgacgcaccggcgggcgctatgcgctcgtgacgacctgc
atcggcggcggacaaggcatcgccgccatctttgaacgtctttga

DBGET integrated database retrieval system