KEGG   Postia placenta: POSPLDRAFT_101343Help
Entry
POSPLDRAFT_101343 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ppl  Postia placenta
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppl00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppl00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:ppl00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:ppl04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 222 aa AA seqDB search
MSLSNSFKNIVVVGAGLTTALLIQEKGGYEVTVVAETLPSDPKTYVHCMLYWRERKCLTG
GLNFQGAYHVIYRGSDERERKIQNDTFKVMWNLSAPGGEAEGCFRRLKTMEYYYDKLEVN
ADEMPGFQEIPEHALAPGTKCGYSFDTYVIDPPVYLNYLMSRFIAHGGTVIRGAVQHVNQ
IVEGGAFIILADTNLEFTNSSRVGRLPWVYLAAEPIEPGISA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcgaactccttcaagaacattgtcgtcgttggcgccggtcttaccactgcg
ctcttgatacaggagaaaggtggctatgaggtaacagtcgtcgctgaaacactccctagc
gatcccaagacgtatgttcattgtatgttatactggagagagagaaaatgcctgaccggt
ggtctcaatttccagggagcataccatgtcatctacagaggttctgacgagagagaacga
aagatccagaacgacacgttcaaggtcatgtggaatctgtctgcaccgggaggggaagcc
gaagggtgcttccgtcgcctcaaaacgatggagtactactatgacaaactggaggtgaac
gctgacgagatgcctggttttcaagaaattcctgaacatgcgcttgcaccaggaaccaag
tgcggctactccttcgacacctacgttattgaccctccggtatacctcaattacctcatg
tctcgcttcatcgcacatggaggcaccgttatccgcggggcagtccaacatgtcaaccag
atcgttgaagggggagcatttattattctcgctgacactaacctggagttcacgaacagc
agccgcgtcggccgtctcccctgggtctatcttgccgccgaacccattgaacctgggatt
tccgcttga

DBGET integrated database retrieval system