KEGG   Postia placenta: POSPLDRAFT_102156Help
Entry
POSPLDRAFT_102156 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ppl  Postia placenta
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    POSPLDRAFT_102156
   00052 Galactose metabolism
    POSPLDRAFT_102156
Enzymes [BR:ppl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     POSPLDRAFT_102156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 260 aa AA seqDB search
MVTPLDASLTPLLLTLPSLTPSLALEVLPLGLTLHRLFVQADGKAGTLPSPLPRPLTCSQ
THDILIGPELPAGHLTQKYTNTIIGRYANRVPAGTHPVSRAGVHSSLTAASNESPSVSLH
GGLSGWDLAPWDPLPDLSAATLFSPDEQQTIAATLPSACVFVRESPNGEEGYPGRLRVEV
LVGLAQSNAPPPAASAEWLLGSVVLIYRARLLDTDKVTPINLTQHWGFNLDASLQDGQSV
KDHTLTIRVRPHPLPPVIQD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccccactcgacgcctcgctcacgcccctgctcctcaccctcccgtccctcacg
ccctctctcgccctcgaggtcctccccctcggcctcaccctccaccgtctctttgtccaa
gcagatggcaaggcaggtacgctcccctctcccctcccacgcccgctcacctgttcgcag
acgcacgacatcctcatcggccccgagctccccgccggccacctcacccagaagtacaca
aacaccatcatcggccgctacgccaaccgcgtccccgcaggcactcaccccgtctcccgc
gctggcgtccactcctctctgaccgctgcctccaacgagtccccctccgtctccctccac
ggcggcctctccggctgggacctcgccccttgggatcccctccctgacctctccgccgcc
accctcttctctcccgacgagcagcaaaccatcgccgcaaccctcccgtccgcctgcgtc
tttgtccgcgagtctcccaacggcgaagagggctaccctggtcgcctgcgcgtcgaggtc
ctcgtcggccttgcccaatccaatgcaccgccccccgccgcctcggcagagtggcttctc
ggcagcgtcgttctcatctatcgtgcacgtcttctagacaccgacaaggtcaccccgatc
aacctcacccaacactggggcttcaacctcgacgcttcgctccaggacggccagtccgtc
aaagaccacaccctcaccatccgtgtacgtcctcatcctctgccaccagtgattcaggac
tag

DBGET integrated database retrieval system