KEGG   Postia placenta: POSPLDRAFT_102475Help
Entry
POSPLDRAFT_102475 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppl  Postia placenta
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    POSPLDRAFT_102475
Enzymes [BR:ppl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     POSPLDRAFT_102475
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 238 aa AA seqDB search
MMQGVSVYSFKDGMGAFVAALKAALERAENVQIVQDAKVSQVSSNDGRFMTLPSAARPPL
PHLASNLSSSVAVVNLVFASPPGAPALHPPGFGFLIPRPAGGDYHAHGDNPMGILGTVFD
SCAVGAQDAGAPITKMTVMLGGPYGMPDTDDPAFLDRLLRELARQLAGPPLPRPLLVRVH
RHAACIPTPAVGHEARMAELRGAVGKYWGACAEVVGAEVGGVSVGACIEMGRSVGREW
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagggcgtgagcgtgtactcgttcaaggatggcatgggcgcgtttgtcgctgct
ttgaaggcagcactcgagcgcgcggagaacgtccagatcgtccaggacgctaaagtgtcg
caagtgtcgagtaacgacggcaggttcatgacactcccatcagccgcccggccgcccctg
ccacatctcgcatccaatctctcctcatccgtcgccgtcgtcaacctggttttcgcttcc
cctcctggtgcacctgctctacatccgccgggattcggctttctcatcccgcgcccggcc
ggcggcgactaccatgcacacggggacaacccgatggggatcctgggcaccgtgttcgac
tcgtgtgcggtgggcgcgcaggacgcgggcgcgcccatcacgaagatgaccgtgatgctg
ggcggcccgtatggcatgccggacaccgacgaccccgcgttcctcgacaggttgctgcgc
gagctcgcacgacagctggcggggccgcctttgccgcggcccctcctcgtgcgcgtgcat
cgccatgcggcgtgcattccgacgccggcggtgggccacgaggcgcgcatggctgagctc
aggggagcggtggggaagtactggggcgcatgtgctgaggtcgtgggtgcggaggtggga
ggcgtgagtgtaggcgcgtgcatagagatgggcaggagtgttggcagggagtggtga

DBGET integrated database retrieval system