KEGG   Postia placenta: POSPLDRAFT_103833Help
Entry
POSPLDRAFT_103833 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 875 aa AA seqDB search
MIKRKHQPTPQDLYKARKQREEEEKEANLPPGLINHGNTCFMNSTLQGLMATELLHNLVF
FEPIPPSVESKFGGSIIAHRSPQLTNGHGLAGQFEHQRVNEMPLGDVFVDVMRKAWDIQQ
GHRRETMSPKELLFTMGRKYDQYLDFRQQDAHEFLRHMLDAMRMEEQDIIKQRQPPPPKE
SRKRGRKHRKPDSPVASTSTADGSSSTDGPPSTPEEQLVSFVDMIFGGHLASILVCEKCK
KVSLTYEEFNDLSLSIKPEDYAKGRKRDRFKRFARKLRGPFRPASGSTQRSSSVPADRAR
RSLETEPHEEEPPVNEGPRRKSFEHVAEDGETEAEMNELLADVHASNANPFSVLHHVISD
ATHGTPPAAAAQAAWAKLGHLPGIEECLRMFTSVEILDGENMVGCHRCWKIAHGKYKPER
QGVVADDDDDDDAGSNGEGTASSPSDQVLGDKLPESVQEPPMSPSSETLSSSPDANGHIS
PASTPAIRSVTSFSDTMSDATSMTAPTTMGSVTATVEKASYPPLVSPTRPTTYGGLPIPS
ISTTGPESPVATSRRSPVDKAGEESSDRRSDSPLGVSPSDDSLLTPKPKRRSKAGTGAED
MKSDSSDDEYDSDSDVSGSTSVYSSRSSVASAAASPVASPRASVENVQTVGSTKKRPKPA
STDPSSAKVSRSKQVILRRMYKRYLIADPPPILVVHLKRFQQTGRTHTVTFTGGVKKLDE
FVSFPEYLDLAPYLAPRREDYGLDDKATRAEAKEASKDARCMYRLYAVVVHIGNMHYAKS
SLQLGGHYVAYTALPPSHPLANSSRPEDSSGSDTPSAHKPSIEIAEGMAKPPKPHRQWAY
ISDTVVRLTTLEEVLKAKAYICGGLLESDIAVSYT
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaggaagcatcagccgaccccgcaggacctatacaaggcgcgcaagcagcgc
gaggaagaggagaaggaggcaaacttgccaccaggtctcataaaccatgggaatacctgc
tttatgaactcgacgctgcaggggctcatggcgacagagctcctgcacaatctcgtattc
tttgagcccatcccgccgtccgtcgagagcaagttcggagggtcgatcattgcgcaccga
tcgccgcagctcacgaacgggcacgggctggccggtcagttcgagcatcaacgagtcaat
gagatgccattgggcgatgtgttcgttgacgtcatgcgaaaagcctgggacattcagcaa
ggtcatcggagggaaaccatgagtccaaaggagctgctattcaccatggggcgcaagtac
gatcagtatttagacttccggcagcaagacgcacatgaattcctgcgacacatgctggac
gccatgcgcatggaagagcaggatattatcaaacaacgccagccgcccccgcccaaggag
tcgcgcaaacgcggtcgtaagcatcggaagccagactccccagttgcatcaacgagcacc
gcggacggttcttcgtccacagacggcccgccctctacgccagaagagcaacttgtgtca
ttcgtggatatgattttcggtggccaccttgcgagcatcctggtgtgcgagaagtgcaag
aaggtctcgctgacatatgaagagttcaatgacctgagtctcagcattaaacctgaagac
tacgccaagggtcggaagcgggaccgattcaagcgcttcgcacgtaagctgcgtggtcca
tttcgtcctgcaagcggaagcacacagcgctcgtcttcggtgcctgcggaccgcgcccgg
cgaagccttgagactgaaccgcatgaagaagagccaccagtgaacgagggccctcgacgg
aagagtttcgaacacgtcgcggaggacggagagactgaagcagagatgaacgaactactg
gcagacgtgcatgcgtccaatgcaaacccgttctccgtcctgcaccatgtaatttcggat
gctacgcacggcacgccgcccgctgctgcagcacaggctgcatgggcaaagctgggacac
ctcccgggtatcgaggaatgcctccgcatgttcacatccgtcgagatattggatggcgag
aacatggttggatgtcacaggtgctggaagatcgcgcacgggaaatacaagcccgaaaga
cagggtgtggttgctgatgatgatgacgacgacgacgcaggtagcaatggagagggaaca
gcaagcagcccctcggaccaagtcctaggagacaagcttcctgaatccgtgcaggagccg
cctatgagcccttctagtgagactttgtcctcgtcgccagatgcaaacgggcatatctcg
cctgcgtccactcctgccatccggagtgtaacatccttctcggacaccatgtctgatgcg
acgtcgatgacagcaccgaccactatgggctctgtgacagccacggttgagaaggcgagt
tatccgccattagtgtcgcctacccgccctacgacctatggcggtctacctatcccctcg
atttcgacgacagggcccgagtccccagtcgcgacgtctcgacgctcgcccgtcgacaaa
gctggtgaagaatcttcagaccggagatcggacagtccactaggcgtctcgccttcagac
gactcactactcacaccgaagccgaaacgtcgctcgaaggccggcacgggcgcagaggat
atgaagagtgatagctctgatgacgagtatgactccgacagcgatgtctcgggtagcacg
tctgtttactcgagccgctcgtctgttgcgtcggccgcagcctcccctgtcgcttcaccg
agagcgtcggtggagaacgtgcagaccgttgggtcgactaaaaagcgaccgaagccagcc
agcaccgatccctcatccgccaaggtgtcgcgctccaaacaagtcatcctccgtcggatg
tacaagcgttacctaattgcggaccctcctccaattcttgtggttcacctgaagcgattc
cagcagacgggccggacgcataccgtcacgttcacgggcggcgtgaagaagctcgacgag
tttgtttcgttcccagaatacctcgatcttgctccgtaccttgcgccgcgcagagaggat
tatgggcttgatgacaaggcgacgagggccgaggctaaggaagcgagcaaggatgcccgg
tgtatgtatcgtctgtatgcggttgtggtccacatcggcaacatgcattatgctaagagt
agcttgcagctgggtggccactacgtcgcatacaccgccttacccccttcgcacccacta
gcgaacagttcaaggccggaagattcgtcaggttctgatacgcctagcgctcataaaccc
tctattgaaattgctgaaggcatggccaagcctccgaagccacacagacagtgggcctac
atcagcgatactgtagtgcgcctcacgacgctcgaagaggtgctcaaggcgaaggcgtat
atatgtggtgggctcctagagtcggacattgctgtatcgtatacctaa

DBGET integrated database retrieval system