KEGG   Postia placenta: POSPLDRAFT_105644Help
Entry
POSPLDRAFT_105644 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ppl  Postia placenta
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ppl03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 414 aa AA seqDB search
MNDFAFIGRTVFDGLRDRREKRYSGKLFIAPTDYMTAPKPDPCLRYLAIRPSPRELKLKS
ELTRCFEKEWVLDAANKQPERALAILYSSWVGPVSYPNRYKLQLLANSMACRPSSPTVDA
LHEVLAASSNASFGGSIYLDDEAVELLGDMRIRENYLTWDQRYSTRCTDNLTGACTAYMG
GHPVKNIGQSCRLGGPAIDSYSVSERWDSEAFFKLDAQWIARRQRPLARKTLLTLAWSLE
ASEDESPAPAPSVPAVKKPVKSKWEGEDEEDKGPVSDWEASSDEEEKPKPSAAPVAAPKK
KGTLKAKLAEKEALKAAQNDDDSDDDDYDEDAVLDPREKARRDKERELNADLSNAADLLG
AAALGGSKPLYAAFLEHHVRELAMPLRDVEVRKTASVLTTLANEKQKEQRDKAS
NT seq 1243 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacttcgccttcatcggacgcactgtcttcgatggactacgcgatcgtcgcgag
aagcggtattcgggaaagctcttcattgcaccaacagactacatgaccgccccgaagccc
gatccgtgtctacgatacctcgctattcgcccttcgccaagagagctgaagctcaagtct
gaactcacacggtgcttcgagaaagagtgggtcttggatgccgcaaacaagcaaccagag
cgcgcactcgccattttgtactcgagctgggttggccctgtttcctatccgaatcggtac
aagctgcagttactagcgaactctatggcctgtcggccgtcgtcgcctacagtggacgcg
ctgcacgaggtgctggccgcgagttcgaacgcttcatttggcggttccatctaccttgat
gacgaggcggtagagctccttggtgacatgagaatccgggagaattatctgacatgggac
cagagatattcgacaaggtgtactgataatcttacgggagcttgtactgcatacatgggc
ggccacccggtgaaaaatataggacaatcttgtcgtcttggcggtccggccatagactca
tattcagtgtccgaaaggtgggactccgaggcgttcttcaagttggatgcccaatggatc
gcacgccgacaaaggccactggcaaggaagacgcttctcacgcttgcatggagtctagag
gcatccgaggatgaatctcccgcgcctgctccctccgtgcccgcggtcaagaagcccgtg
aagagcaaatgggagggcgaagatgaagaggacaaggggcctgtgagcgactgggaggcc
tcctcggacgaagaggaaaaaccgaaaccgtctgcagcgcctgtggcggcgccaaagaag
aagggaacgctgaaggcgaagcttgcagagaaggaagctttgaaggcagcgcaaaacgac
gacgacagcgacgacgatgattatgatgaggacgcagtgctcgatccccgagagaaggca
cgccgggacaaggagagggagctcaacgcggatctgagcaatgcagcggatctactcggc
gctgccgccctcggaggcagcaagccgctgtatgcggcgttcctcgaacaccacgtgcgc
gagctcgcgatgcccttgcgtgatgtcgaggtacgcaagacggcaagcgtgctcaccacg
cttgcgaacgagaagcagaaggagcagcgcgacaaggcgtcgg

DBGET integrated database retrieval system