KEGG   Postia placenta: POSPLDRAFT_106202Help
Entry
POSPLDRAFT_106202 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ppl  Postia placenta
Brite
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     POSPLDRAFT_106202
Peptidases [BR:ppl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   POSPLDRAFT_106202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1102 aa AA seqDB search
MLPPMLYDLFHDPNHTLYNISLKESQLATLQSATSIPHAPSLEEVVETVPHPHAYFCKEH
NGWVLLLWRNSSVLPKLARKLDRLPDHDRRKRTGSCVGEGEQPFGQANVTHHWHRYERAV
DARDLNPPFMREDTLLDLYVCCQCSMYCLVSDIIPGVIPRQLVDEYTRDRLAHPPIERTP
TASVLMGWETFISIIEKRLWQDEQRILPVKRARFQQKVGWSETVKQIFDVLGFPMSIVPE
TNALGTYKPQVLNAQALDVYELLQTKIGAHVSQIPRGLLPDALVGLDILDSAWKELGMTQ
TTYSWEMLAFAYLAQCRCDPANTPDYFTALFHIAQALNNVGEAAPELQQLIIEERTRYRY
SREDLAEAIAVLGFGKDRELRVELDADVDDQFILEAWRSARRRAWRESNANDLRHRLNEA
LRMLADDRGSALLRKAWDEEKGTGMSPDAAYSTLEVPREVEETMLITVYVMRVEDQPGQA
DRMREAMNVIAEVTNSDRLRQFLTTGNDPGDATAQVMSSDMPRGLNQLGNTCYLNSLLQY
FYTIKDLREAVAPLANADAKSLDDSKVTDDDLKRHRVGGRLVTRREILRSKKFVSQLADL
FWNLEYCDVPAVTPSIDLAKLALVTSQDEEEDDQDRTGTESSNDTDATLVEDAPSRTGHE
RSSPSPLDSPTGSVLGKRHRDTADIPMEPERSSPQEETRPPSASSSAQSPQAVASSSRLE
PADRTFDVEMQDVSQQAQKAPPLPARRPRPIDDSVMMFGRQHDVSECMDNCMFQIETALL
DFQGNAGADNDKTSVVKRLFYGKKRQRLTPLSAADDARHKASIHEKEDLFSHLHVNVSDE
GFDLYDGLARYFDDIVELEGFKKLMEVSVVDLPPLLQIQLQRVQFDRETQQAYKSQAYIK
FDETIYMDRFLDSADREKQTRAKAIQADLTATRDHIQRLTKDKHAPFAPALAATAEFLST
QDVIQLPDVDDQLLSSLRNEQELITAQLEQERQKAVQLKREIDEIWKDDTSAAYELTSVF
IHRGSSPSWGHYFFYARNLPENPDQWFKYNDSDVSVVSKDEVLADTTGSTANPYMLVFAR
KESEVIQTVHRFDPSKLAEAEG
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgcttccacccatgctctacgatttattccatgatcctaatcacaccctgtacaacatt
agcctcaaggaatcccaattagcgaccttacagtcagcgacctcgattccacacgcgccc
tcactcgaggaggttgtggagaccgttcctcatccgcacgcgtacttttgcaaggagcac
aatggttgggtattacttctctggcggaattcaagcgtcctccccaagcttgcccgcaaa
ctcgaccgccttccggaccatgatcgtcgcaagcggaccggctcatgcgttggtgagggc
gagcagccgtttggccaggcgaacgtaacccatcactggcaccgttacgagcgtgctgtc
gacgctcgcgatctcaatccgccctttatgcgtgaagacactttgctagacctttatgtc
tgctgccaatgttcgatgtactgcttagtatcagacatcattcccggtgttatcccacgg
cagttggtcgacgaatacactcgcgacaggcttgctcatccgccgattgaaaggacacca
acggcgagcgttctgatgggttgggagacgttcatctccatcattgagaaacgtctatgg
caggacgagcagcgcatactgcccgtcaagcgcgcccgattccagcaaaaggtcggctgg
agcgagacagtcaagcagatctttgatgtcttaggctttcccatgagcatagtgccggaa
actaacgcacttgggacatacaagccgcaggtgttgaacgcgcaagcactcgacgtttac
gagttgttgcaaactaagatcggcgcgcatgtttcgcaaatcccccgcggccttttacca
gatgcgctcgttggccttgatatactcgattccgcgtggaaggagctcggcatgacacaa
acaacatactcatgggaaatgcttgccttcgcttatctcgcccagtgccgctgcgatccc
gcgaacactcctgactactttacggctctctttcatatcgcacaagcactcaacaatgtc
ggggaggctgcgccagagctgcagcagcttataatcgaggagcgcacccgctatcgctac
tctcgagaggacctcgcagaggccatcgcggtactcggcttcggcaaggaccgcgagctg
cgcgtagagcttgatgcggatgtcgatgaccagttcatccttgaggcatggcggagcgca
cggcggcgcgcgtggcgggaatcaaacgccaatgacctgaggcacagactcaacgaagcg
ctccggatgctggccgacgaccgcgggagcgcactactgcgtaaggcttgggacgaggaa
aagggtacgggcatgtcaccagacgcagcgtactcaacgctcgaggtgccacgggaggta
gaagagacgatgctaattaccgtctacgtgatgcgggttgaggaccagccaggccaggca
gacaggatgcgcgaagcgatgaacgtaatcgccgaggtcacgaatagcgataggctacgt
caatttctcactacgggtaatgaccctggtgatgcaaccgctcaagtgatgagctcagat
atgccccgcggtttgaatcagctcggaaacacgtgttacttaaactctctgctccagtat
ttctacaccatcaaagacctacgcgaggctgtcgcacctttggccaacgccgacgcaaag
tccctcgacgacagcaaagtcactgacgatgacctcaaacgacacagagtaggtggccgg
cttgtcacccgccgcgagatcctacgatcaaagaagttcgtgagccagctcgcggatctg
ttctggaacctcgaatattgcgacgtccccgccgtcacaccatctatcgatctcgcgaaa
ctggcacttgttacctcgcaggacgaggaagaggacgatcaagataggacaggcaccgaa
tcatcgaacgatacagacgcaaccttagtcgaagacgctccttcgcgcactggtcacgaa
cgctcatcgccctcgcctctcgatagccctactggcagcgtcctcgggaagcgtcatcgt
gacacggctgacattcctatggagccagaacgctcgtcacctcaggaggagacaagaccg
ccgtcagcgtcgtcctccgcacaatcaccacaagcagtagcatcttcctcgagactcgag
cctgctgaccggacattcgatgttgaaatgcaagatgtttcgcagcaagcccagaaggca
ccacccttacccgcacggcgaccacgacccattgacgactccgtgatgatgtttggtaga
cagcacgatgtgtcagagtgtatggacaattgtatgttccaaatcgagaccgcgttactc
gacttccagggcaacgccggcgccgacaatgacaagacaagcgtagtgaagagacttttc
tatggcaagaagcgccagcgtcttacgccgctatctgctgctgatgacgcgcggcacaag
gcttccattcatgagaaggaagacttgttctcgcatctgcatgtcaatgtctcagacgag
ggattcgatctgtacgatgggttagcccggtacttcgatgatatcgttgaattggaaggc
ttcaagaagctaatggaggtctccgtggtggatctcccgccattactacagatccagctg
cagcgcgtacaattcgatcgcgagacgcagcaggcgtacaagtcacaagcatacatcaag
ttcgatgaaacaatctacatggaccgattcttagatagtgcagaccgggagaagcagacg
cgcgcaaaggcaatccaagctgatttgacagccacccgggaccacattcagcggctcaca
aaagacaagcacgcgccgttcgctcctgccctggctgcaactgccgagtttctctcaaca
caggatgttattcagctacctgacgttgacgaccaactgctatcaagtctgcgcaatgag
caagagctcatcactgcgcagctcgagcaggaacgacaaaaggccgtgcaattgaagcga
gagatcgacgagatttggaaagatgatacgtcggcagcatatgagctcacatctgtgttc
attcatcgcggctcgtcaccatcttggggtcattactttttctatgcccgcaatctcccg
gagaaccctgaccaatggttcaaatacaacgactcggacgtcagcgttgtctctaaagat
gaggtcctggcagatacgaccggttccaccgcgaacccgtatatgcttgtctttgcccgc
aaagaatctgaggtgattcagaccgttcaccggttcgatccatcgaagctggccgaagcc
gaaggttga

DBGET integrated database retrieval system