KEGG   Postia placenta: POSPLDRAFT_106657Help
Entry
POSPLDRAFT_106657 CDS       T01162                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppl  Postia placenta
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ppl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppl01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 394 aa AA seqDB search
MSVPSPPSAANPDVWWWNAGFFISVHIAAILGVWLYPYYAVHRATLALAFALFQISEISI
TVGYHRLYSHRSFRAARSVRVFLALMGAGAMQGSIKRFTDDPVHDPYAATRGLLWSHMGW
IFFKPRYDRLKVIEQDDLRSDPVPLALLIGFVLPPVAGWLWGDPYGAFVWGALVARVLIW
HCTFFVNSLAHWDGLQPYSDENTSKSNLHAFPHDYRSGPCPFDWDPSKWVILALHTLGLA
TGLKRARPDDVSEALIYMAHKHHAPLNSEPPHSSESSSEDEEMWKGAVWTWQEAAGYVRQ
GRGAGRCVLVVDGFAVDVTGYLGEHPGGATLLRKHSVRIGFDPTNADDKTWQEADWAFHG
GYNIHTRAAHKRMRALRVAKISGLDIVKDRSSSI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtccccagtccaccctccgctgccaatccggatgtgtggtggtggaacgctggc
ttcttcatttccgtacacattgctgccatcttaggtgtctggttatatccatactatgcc
gtacatcgggctacccttgcgctcgctttcgctcttttccagatatcagagatttcaatc
accgtcggttatcatcgactctactcacatcggtccttcagggcggctcgtagcgtcaga
gtgttcctcgcactcatgggtgcaggggcaatgcaaggctccattaagcgcttcaccgat
gatcctgtacacgacccttacgctgcaacgcgaggtcttctctggtcacacatgggctgg
atcttcttcaaaccacgctatgatcgcttaaaggtgatcgagcaggacgacctgcggagt
gatccagtcccccttgcactgctgattggatttgtcctcccaccggttgctggatggctc
tggggcgacccatacggtgcgtttgtctggggtgccctcgttgcgcgggttctcatctgg
cattgtacgttctttgtgaactcgctcgcacattgggatggtctgcagccctactctgat
gagaacacatcgaagtccaaccttcatgctttcccccacgactaccgctcgggaccctgc
ccctttgactgggatccgtctaaatgggtcattcttgcccttcacacccttggcctagcc
acgggcttgaagcgcgctcgcccagacgacgttagcgaggccctcatatacatggcccac
aagcaccacgcgcccctgaactccgaaccgccccattcctccgaatccagctcagaggat
gaggagatgtggaagggagcagtctggacatggcaagaagcggcgggctacgtccgtcaa
ggcaggggtgcaggaagatgcgtactggtcgtcgatggcttcgctgtagatgtaacagga
taccttggcgagcaccctggcggcgcgactctcttgcgtaaacactccgttcgcatcggc
ttcgatccaacgaacgcggatgataagacctggcaggaggcagattgggctttccacgga
gggtacaacatccacacgcgcgcggcgcacaagcgcatgcgcgcgctcagggtggcgaag
atctcggggcttgacattgtcaaggatcggtcttcgtcgatctga

DBGET integrated database retrieval system