KEGG   Postia placenta: POSPLDRAFT_110441Help
Entry
POSPLDRAFT_110441 CDS       T01162                                 

Definition
candidate 1,4-alpha-glucan branching enzyme from glycoside hydrolase family GH13
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppl  Postia placenta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POSPLDRAFT_110441
Enzymes [BR:ppl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     POSPLDRAFT_110441
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   POSPLDRAFT_110441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 682 aa AA seqDB search
MPTTPIDAKTVLDVDPWLEPNAPSIVHRHNAFRKWRDTIEQNEGGYDSFTKGYLKFGLHV
RDDGELVYREWAPNAKEAALIGDFNNWNRTSHPMVKDSFGVWEITIPPKEPGVCAIPHDS
KIKISMITPSGERIERLPVWIKRVTQDLSVSPVYDARFWNPPQSERYQFKNARPPQPRSV
RIYEAHVGISTNEYRVGTYKEFTAHMLPRIKDLGYNTIQLMAVMEHAYYASFGYQVTNFF
AASSRYGTPEDLKELIDTAHGMGITVLLDIVHSHACKNVLDGLNQFDGTDHQYFHEGGKG
RHELWDSRLFNYGHYEVLRFLMSNLRFWMEEYQFDGFRFDGVTSMMYVHHGIGTGFSGGY
HEYFGDNADIEAIVYLMLANDAMHELFPSCITIAEDVSGMPLLCAPVSKGGVGFDYRLSM
AIPDMWIKLLKHKSDDEWEMGNIVHTLTNRRYKEKSIAYAESHDQALVGDKTLAFWLMDK
EMYTNMSDITEYTPVIARGIALHKMIRLLVHSLGGEGYLNFEGNEFGHPEWLDFPREGNG
NSFHYARRQWNVVDDPLLRYKYLNEFDKAMNHTEEKYGWLAAEPAYVSLKHEVDKVVVFE
RAGLLFVFNFHPSQSFTDYRVGVEEPGEYHVVLSSDEKRFGGFENVLPGGQYFTTPMEWN
GRKNWLQQIYIPTRTCIVLGKN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgacgcctatcgatgcgaagactgtgctcgatgtcgacccctggcttgaaccc
aatgcgccctcgattgtgcatcgacacaacgcgtttaggaaatggcgcgatactatagag
cagaacgaggggggttacgactcgttcacgaagggctatctcaagtttgggctccatgta
cgcgacgacggcgagctcgtgtacagggagtgggcaccgaacgcgaaggaggcggccttg
atcggcgacttcaacaattggaataggacctcgcatccgatggtcaaagactcctttggc
gtgtgggagatcaccatcccgcccaaagaaccaggtgtatgcgctatcccgcacgactcc
aagatcaagatctcgatgatcacaccatcaggcgagcgcattgagcgactcccagtctgg
atcaagcgcgtcacgcaggatctgtctgtttctcccgtctatgatgcccgattctggaac
ccaccccagtcagagcgatatcagttcaagaatgctcgtcctcctcagccgaggagtgtg
cggatatatgaagcccatgtcgggatctcgacgaacgagtatcgcgtagggacatacaag
gaatttactgcccacatgctgccgagaatcaaggatctcggctacaacaccatccagctc
atggcagttatggagcatgcgtattatgcttcgtttgggtaccaagttacaaactttttt
gcagcaagttcccgctatggtacacctgaagacctcaaagaactcatagacaccgcgcat
ggcatgggaatcacagttctcctcgacattgtgcactcgcatgcctgtaagaacgtgctc
gatgggctcaaccaattcgacgggacggaccatcagtacttccacgagggtggaaagggg
cggcatgagctctgggatagtcgtctattcaactacggccactacgaggtgcttcgcttc
ctcatgagcaacctacgcttctggatggaggagtaccagtttgatggcttccgattcgat
ggggtgacgagcatgatgtacgtgcatcatggaatcggcaccgggttctctggtggatat
cacgaatacttcggagataatgcggatatcgaggccatcgtgtatctcatgctggccaat
gacgcaatgcatgaactcttcccatcgtgcatcactattgcagaggatgtctccggcatg
ccccttctctgcgcccccgtctcgaaaggtggggttgggttcgactatcggctatcgatg
gcaatcccggacatgtggataaagctgctgaagcacaagagtgacgacgagtgggagatg
gggaacatcgtgcacaccttgacaaaccggcgatacaaagagaagagcatcgcgtacgcc
gagagtcacgaccaggcgctagtaggggataagaccctcgcgttctggctgatggacaag
gaaatgtacacgaacatgtcggatataacggagtatacacctgtcatcgctcgaggtatt
gcgctgcacaagatgatacgactgttagtgcattcgctgggcggtgaaggatatctcaac
tttgaagggaacgaattcggccatccggagtggctcgacttcccgcgtgagggcaacggc
aactccttccactacgcccggaggcagtggaacgttgtcgatgatcctctcttgcgctac
aagtatctcaacgagttcgataaggctatgaaccacacagaggagaaatacggctggctt
gcggccgagcctgcttacgtctctctgaaacacgaagtcgacaaagtggtcgtgttcgag
cgcgcggggctactattcgtgttcaatttccacccgtcgcaatcattcacggactatcgt
gtcggagtggaggagcccggggagtaccacgttgtcctgagcagcgacgagaagcgcttc
ggcggcttcgagaacgtgctcccgggtgggcagtacttcacaacgcccatggaatggaat
gggagaaagaactggttacagcagatctatattccgacgcgtacctgcatcgtccttgga
aagaattga

DBGET integrated database retrieval system