KEGG   Postia placenta: POSPLDRAFT_112798Help
Entry
POSPLDRAFT_112798 CDS       T01162                                 

Definition
candidate cAMP dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ppl  Postia placenta
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ppl04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 386 aa AA seqDB search
MTDKLGHRGPNKAPAHSSPSSSFSSNSLSAISQEHRGSLSTERTSASAWSRKAEGQDSDK
RDDGLIELPLHLQNQKPKGSYRLSDFFIQRTLGTGSFGRVHLVRSKVNLRFYAIKVLSKE
KIVRTKQVSHTRNEQMMLQAVQHPFIINLWGTFQDSANLYMRFPDPVAKFYAAEVALALN
YLHSLDIIYRDLKPENILLNFDGHIKIADFGFAKYCNTTVWTLCGTPDYLAPEIIGHMRY
NKSVDWYALGVLIYEMLSGLPPFHEPDITPVRLYEKIAQGPACIKWPNISPSATDLIMKF
MERDPSKRYGNLHHGAGDVFAHPWFREVDWERLRNREIQAPYMPKIAGDGDASAFESYPE
IDAAHLYGASAPDPYGDQFPDFDYAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaagttggggcatcgcgggcccaacaaggctcccgcgcattcttcaccatcg
tcttcgttctcctccaattctctgtccgccatctcacaggaacaccgcggatcgttgtcc
accgagcgcacctccgcgagcgcatggagtcggaaagccgaaggccaagattcggacaaa
cgcgacgatggactaatcgagctcccccttcacctacaaaatcagaaaccgaaaggctcg
taccgcctaagcgatttcttcatccagcgcacgctagggacgggaagctttggacgcgtc
cacttggttcggagcaaagtcaacctgcgcttttatgccatcaaagtgctcagcaaagaa
aagattgtgcggacaaaacaggtctcgcacacgcgcaacgaacagatgatgctgcaggca
gtgcaacatccattcatcatcaacctctggggtacgttccaggacagcgcgaacctctac
atgagattcccggaccctgtagcaaaattctacgcagcggaggtcgctctcgcgctgaac
tatcttcattcgctcgacatcatttatcgcgacctgaagccggagaatatccttcttaac
ttcgatggccatatcaaaattgcagatttcggcttcgccaagtactgcaacacgactgtc
tggaccctctgcggtactccggactatctggcgcctgagatcatcggtcacatgcgatac
aacaaatccgtcgactggtacgccctcggggtgctcatttacgagatgctctcaggcttg
ccgcccttccacgaacccgacatcacgccagtgcggctgtacgaaaagattgcgcagggc
cccgcatgcatcaaatggccgaacatcagcccgagcgcgacggacttgatcatgaagttc
atggagcgcgacccgtcgaagcgctacggcaacctgcaccacggcgcgggcgacgtgttt
gcgcatccgtggttccgcgaggtcgactgggagcgactgcgcaaccgcgagatccaggcg
ccgtacatgcccaagatcgccggcgacggcgacgccagcgcgttcgaaagctaccccgag
atcgacgctgcgcatctgtatggtgcttctgcacccgatccctatggggaccagttcccg
gacttcgactatgcagcatag

DBGET integrated database retrieval system