KEGG   Postia placenta: POSPLDRAFT_113052Help
Entry
POSPLDRAFT_113052 CDS       T01162                                 

Definition
candidate MAP kinase kinase
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ppl  Postia placenta
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    POSPLDRAFT_113052
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     POSPLDRAFT_113052
Protein kinases [BR:ppl01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   POSPLDRAFT_113052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 351 aa AA seqDB search
MQPDWTGMFGTGSDPSGALNFSGKAVLHAQGVNFSNGSSFSISMSQLQLEDELGKGAYGT
VKKVLHKPTNVAMAMKEIRLELDESKLNAIIMELDILHRAISPEIIEFYGAFFIESCVYY
CMEYMDAGSLDKLQGAGVPEDVLGRISGSMVRGLKFLKDELQIIHRDVKPTNVLVNSKGE
IKLCDFGVSGQLEKSLAKTNIGCQSYMAPERIKGESQNNVGTYTVSSDVWSLGLSMIEMA
IGRYPYPPETYANVFAQLTAIVHGDPPELPDTYSEDCRDFVNRCLHKVPEMRATYAELLD
HQFMRQDRDRQVDMPKWVVGALDYRKRKHAEDRQKKLLLQDGSTSAPPGTS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgactggactggaatgttcgggaccggtagcgatccgtccggagcgctcaac
ttcagcgggaaggccgtgctgcacgcgcagggcgtcaacttcagcaatggctcgtctttt
tccatcagtatgtcgcagctacagctcgaggacgagctcggcaagggcgcgtacgggact
gttaagaaggttctgcataagcccacgaatgtcgcgatggccatgaaggaaattcgactg
gagctcgatgagtcgaagctaaacgcaataatcatggagcttgatattcttcatcgagcc
atatctccagagattattgagttttacggcgcattcttcatcgaatcttgcgtttattac
tgcatggagtacatggacgcgggctcgcttgacaaactgcaaggcgcgggcgtgccggag
gatgttctcgggcgtattagtgggagcatggtccgagggctaaagttcttgaaggatgaa
ttacaaataatccatcgcgatgtgaagccgacgaacgtgctggtgaactcgaaaggtgaa
atcaagctatgtgactttggtgtatctgggcagcttgagaagtcgctagcgaagacgaat
atcgggtgccagagctacatggcgccggagcggattaaaggcgagtcgcagaataacgtc
ggcacgtataccgtctcctccgacgtctggtcgttgggcctctcgatgatcgagatggcg
ataggccggtatccgtacccgccggagacgtacgccaacgtattcgcccagctcactgcc
atcgtgcacggggatcctcccgagcttccagacacgtactcggaggattgcagagacttc
gtcaatcggtgtttgcacaaagtgcctgagatgcgggcaacgtacgcggagttgctggac
caccagttcatgcgacaagatcgagatcgccaggttgacatgccgaaatgggttgttggc
gcgctagactatcgcaagcggaaacatgcagaggaccgccaaaagaagctactgctgcag
gacggcagcacctccgccccgccaggaacatcgtaa

DBGET integrated database retrieval system