KEGG   Postia placenta: POSPLDRAFT_113082Help
Entry
POSPLDRAFT_113082 CDS       T01162                                 

Definition
candidate kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ppl  Postia placenta
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ppl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 443 aa AA seqDB search
MHSIPRPLGPRGLRASSPSPYGLPEVAPLNIRKVSGTAPRKPALKLPQIDFDKVDGGAFA
GAHADGAPPSYTSHSHSDSPGDLTVRPDQTVSPHPRMPAAVVSMENIRQTVEEFDEWSDD
YLDVINRLGEGAGGAVDRVRDRRTGRVMARKTITTLEAPMKQLMREIKITSSTSHGNIIH
FFGAYISPSSSEVKVLMEFCEGGSLESVGKRMKEIGGRVGEKVAGRLAEGILQGLAYLHK
LKTIHRDIKPPNILLTREGVVKLCDFGVSGELVNSLAGTFTGTSLYMAPERLSGLEYTIR
SDVWSTGISLLELVQNRFPFPSDLAAIELMFHITQNEPPELEDEEDITWSPEMKDFIKKA
LTRDPLVRPTPKDMLAHPWIVNIMLHEVNMASWMRQVWGWRKSRKAGETSSRPGSSRSDA
ASSLDATMAHLSLGGDLDSASAA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcactccatcccccgccccctcggccccaggggtctcagggcgtcctcaccgtccccc
tacggcctccccgaagtcgctcccctcaacatccgcaaagtcagtggcacggcgccccgc
aagcccgccctcaagctgccccagatcgacttcgacaaagtcgacggcggcgccttcgcg
ggagcccatgccgacggcgcgcccccctcgtacacctcgcactctcacagcgacagcccg
ggcgacctcaccgtccgccctgaccagacagtctcgcctcacccacgcatgcccgccgca
gtagtctccatggagaacatccgccagacggtggaagagttcgacgagtggtccgatgac
tacctcgacgtcatcaatcgcctcggcgagggtgccggcggcgcggtcgacagggtcagg
gacaggcgcacgggcagggtcatggcacgcaagacgatcacgaccctcgaggctcccatg
aagcagctcatgcgcgagatcaagattacatcctcgacgtcgcacggcaacatcatccac
ttcttcggcgcgtacatctcgccgtcctccagcgaggtcaaggtcctcatggagttctgc
gagggcggcagtctcgaatcggtcgggaagcgtatgaaggagatcggcgggcgcgttggc
gagaaggtcgccgggcggctcgcagagggcatcctgcagggtctcgcatacctccacaaa
ctgaagacgatccaccgcgatataaagcccccgaacatcctcctcacgcgcgagggtgtc
gtcaagctctgcgactttggcgtctcgggcgagcttgtcaactccttggctggcaccttc
acaggcaccagcctctacatggcgccggagcgtctgtccggtctggagtacactatcaga
tcggacgtctggtccacgggcatctccctactcgagctggtccaaaaccgtttcccattc
cccagcgatctggccgcgatcgagctgatgttccacattacgcaaaatgagccgccagaa
ctcgaagacgaggaggacataacctggagccccgaaatgaaggatttcattaagaaggcg
ctcacgcgggaccccctggtacgtccgacgccaaaggacatgctggcgcacccatggata
gtcaacatcatgctgcacgaggtcaacatggcgtcctggatgcgccaggtctggggctgg
cgcaaaagcagaaaggcaggcgagacatcctcgcggccaggctccagccgcagcgacgcg
gcgtcgtcgctcgacgccaccatggcccacctctccctcggtggggacctggactccgcg
tccgcggcgtaa

DBGET integrated database retrieval system