KEGG   Postia placenta: POSPLDRAFT_113112Help
Entry
POSPLDRAFT_113112 CDS       T01162                                 

Definition
candidate glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ppl  Postia placenta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    POSPLDRAFT_113112
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     POSPLDRAFT_113112
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 569 aa AA seqDB search
MRLTVVSGLAYACGALAASSSVGSYIASESPVAKAGVLANIGAGGSKSSGAYSGVVIASP
STSNPDYLYTWTRDSSLTFKALIDQYTSGEDTSLRTLIDEFVSAEATLQQVTNPSGSVST
GGLGEPKFNINETAFTGAWGRPQRDGPALRATAVMSYATYLYNSGNTTYVTDTLWPIIEL
DLNYVAGNWNQSTFDLWEEVDSSSFFTTAVQHRSLRQGIIFANLIGQTSVVSNYETQAEA
LLCFLQSYWNPTDNYVTANTGGGRSGKDANTVLASIHTFDLDAGCDATTFQPCSDKALSN
LKVYVDSFRSIYTINDDISSDAAVATGRYPEDTYYNGNPWYLCTLAVAEQLYDALIVWDA
QDYLEVTSTSLAFFQQFDSSVAAGTYDSSTSTYSTLTSAVKSFADGFTLIVANYTPSDGE
LSEQYSKSDGSQTSAVDLTWSYASALTAFAAEAGTSYGSWGAANLSTSSCPSTSGVSVTF
EVEYDTEYGENLYITGSVSELEDWSADDALIMSSANYPTWSITVTLPASTAIQYKYLTKY
NGDVTWEDDPNNEITTPASGSVTQSDSWH
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcacagtcgtctctggtcttgcctatgcgtgcggagccctcgcggcgtccagc
agcgtcggctcgtacatcgcttccgagtcgccggtcgcgaaggccggcgtgctcgccaac
atcggtgcgggcggctcaaagtcgtctggtgcttattccggcgttgtgatcgccagtccc
agcacgtccaacccggactacttgtacacctggacgcgcgactcgtcgctgacgttcaaa
gcgctcatcgaccagtacacgtccggcgaggacacctcgctgcgcacgctgatcgacgag
ttcgtctccgccgaggcgaccctgcagcaggtcacgaaccccagcggcagcgtgagcacc
ggcggactcggcgagccgaagttcaacatcaatgagacagcattcactggagcctggggc
aggccgcagcgcgatggccccgctctgcgtgcgacggccgtcatgtcgtacgcgacgtac
ctatataacagtggaaacacgacgtatgtcaccgacacgctctggcccatcattgagctc
gacctcaactatgttgcgggtaactggaaccagtcaacctttgacttatgggaggaagtg
gattcgtcctcgttcttcactaccgctgttcagcaccgttcccttcggcaaggaatcatc
ttcgcgaacttgatcggccaaacctctgtagtttccaactacgagacacaggccgaggct
cttctgtgttttctgcagtcatactggaaccctactgacaattacgtgaccgcgaacact
ggcggtggacgctccggtaaggatgccaacaccgtcttggcttcgattcacacattcgac
ctggacgccggctgcgacgcgacgaccttccagccgtgctcggacaaggcgctctcgaac
ctcaaggtctatgtcgactcgttccggtcgatctacaccatcaatgatgacatctcatcc
gacgcagccgtcgcgaccgggcggtaccccgaggacacatactataatggaaacccgtgg
tacctatgcacgctcgccgtcgctgagcagctgtacgacgcgctcattgtgtgggacgca
caggactacctcgaggtgacgagcacgtcgctcgcgttcttccagcagttcgactcgtct
gtcgccgcggggacgtacgactcgagcacgagcacgtacagcacgctcacgagcgcggtc
aagagcttcgcagacggcttcacgctcatcgtcgcgaactataccccgtccgacggggaa
ctgagcgagcagtactccaagtcggacgggagccagacgagcgcagtggacctgacgtgg
agctacgcgtcggcgctgacagcgttcgccgctgaggccgggacatcgtacggcagctgg
ggcgcagcgaacctgtcgacatcgtcgtgcccgagcacgagcggcgtgtctgtgacgttc
gaggttgagtacgacacggaatatggagagaatctgtacatcaccgggtccgtttcagaa
ttggaggactggtcggccgacgacgccctgatcatgtcctccgcgaactacccgacatgg
agcatcacagtgaccttgcctgcgagcacggccatccagtacaagtatctgacgaagtac
aacggtgacgtcacctgggaggacgacccgaacaacgagatcacgacacccgcgagcgga
agcgtgacgcagtcggatagctggcattga

  All links  
No link information was found.   
DBGET integrated database retrieval system