KEGG   Postia placenta: POSPLDRAFT_113112Help
Entry
POSPLDRAFT_113112 CDS       T01162                                 

Definition
candidate glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ppl  Postia placenta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppl00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 569 aa AA seqDB search
MRLTVVSGLAYACGALAASSSVGSYIASESPVAKAGVLANIGAGGSKSSGAYSGVVIASP
STSNPDYLYTWTRDSSLTFKALIDQYTSGEDTSLRTLIDEFVSAEATLQQVTNPSGSVST
GGLGEPKFNINETAFTGAWGRPQRDGPALRATAVMSYATYLYNSGNTTYVTDTLWPIIEL
DLNYVAGNWNQSTFDLWEEVDSSSFFTTAVQHRSLRQGIIFANLIGQTSVVSNYETQAEA
LLCFLQSYWNPTDNYVTANTGGGRSGKDANTVLASIHTFDLDAGCDATTFQPCSDKALSN
LKVYVDSFRSIYTINDDISSDAAVATGRYPEDTYYNGNPWYLCTLAVAEQLYDALIVWDA
QDYLEVTSTSLAFFQQFDSSVAAGTYDSSTSTYSTLTSAVKSFADGFTLIVANYTPSDGE
LSEQYSKSDGSQTSAVDLTWSYASALTAFAAEAGTSYGSWGAANLSTSSCPSTSGVSVTF
EVEYDTEYGENLYITGSVSELEDWSADDALIMSSANYPTWSITVTLPASTAIQYKYLTKY
NGDVTWEDDPNNEITTPASGSVTQSDSWH
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcacagtcgtctctggtcttgcctatgcgtgcggagccctcgcggcgtccagc
agcgtcggctcgtacatcgcttccgagtcgccggtcgcgaaggccggcgtgctcgccaac
atcggtgcgggcggctcaaagtcgtctggtgcttattccggcgttgtgatcgccagtccc
agcacgtccaacccggactacttgtacacctggacgcgcgactcgtcgctgacgttcaaa
gcgctcatcgaccagtacacgtccggcgaggacacctcgctgcgcacgctgatcgacgag
ttcgtctccgccgaggcgaccctgcagcaggtcacgaaccccagcggcagcgtgagcacc
ggcggactcggcgagccgaagttcaacatcaatgagacagcattcactggagcctggggc
aggccgcagcgcgatggccccgctctgcgtgcgacggccgtcatgtcgtacgcgacgtac
ctatataacagtggaaacacgacgtatgtcaccgacacgctctggcccatcattgagctc
gacctcaactatgttgcgggtaactggaaccagtcaacctttgacttatgggaggaagtg
gattcgtcctcgttcttcactaccgctgttcagcaccgttcccttcggcaaggaatcatc
ttcgcgaacttgatcggccaaacctctgtagtttccaactacgagacacaggccgaggct
cttctgtgttttctgcagtcatactggaaccctactgacaattacgtgaccgcgaacact
ggcggtggacgctccggtaaggatgccaacaccgtcttggcttcgattcacacattcgac
ctggacgccggctgcgacgcgacgaccttccagccgtgctcggacaaggcgctctcgaac
ctcaaggtctatgtcgactcgttccggtcgatctacaccatcaatgatgacatctcatcc
gacgcagccgtcgcgaccgggcggtaccccgaggacacatactataatggaaacccgtgg
tacctatgcacgctcgccgtcgctgagcagctgtacgacgcgctcattgtgtgggacgca
caggactacctcgaggtgacgagcacgtcgctcgcgttcttccagcagttcgactcgtct
gtcgccgcggggacgtacgactcgagcacgagcacgtacagcacgctcacgagcgcggtc
aagagcttcgcagacggcttcacgctcatcgtcgcgaactataccccgtccgacggggaa
ctgagcgagcagtactccaagtcggacgggagccagacgagcgcagtggacctgacgtgg
agctacgcgtcggcgctgacagcgttcgccgctgaggccgggacatcgtacggcagctgg
ggcgcagcgaacctgtcgacatcgtcgtgcccgagcacgagcggcgtgtctgtgacgttc
gaggttgagtacgacacggaatatggagagaatctgtacatcaccgggtccgtttcagaa
ttggaggactggtcggccgacgacgccctgatcatgtcctccgcgaactacccgacatgg
agcatcacagtgaccttgcctgcgagcacggccatccagtacaagtatctgacgaagtac
aacggtgacgtcacctgggaggacgacccgaacaacgagatcacgacacccgcgagcgga
agcgtgacgcagtcggatagctggcattga

DBGET integrated database retrieval system