KEGG   Postia placenta: POSPLDRAFT_116648Help
Entry
POSPLDRAFT_116648 CDS       T01162                                 

Definition
(GenBank) mitogen activated protein kinase-like protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppl  Postia placenta
Pathway
ppl04011  MAPK signaling pathway - yeast
ppl04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    POSPLDRAFT_116648
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    POSPLDRAFT_116648
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     POSPLDRAFT_116648
Protein kinases [BR:ppl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   POSPLDRAFT_116648
Chromosome [BR:ppl03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     POSPLDRAFT_116648
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   POSPLDRAFT_116648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Haspin_kinase APH Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: EED85083
JGI: 116648
UniProt: B8P2A6
AA seq 360 aa AA seqDB search
MPDVEDRAPAATNFIVGNNYQVLDVIGEGAYGVVCSALHIPSERKVAIKRITPFDHSMFC
LRTLREIKLLRHFHHENIISILDILRPPSLADFKEVYLVQELMETDLHRVIRTQELSDDH
CQYFIYQTLRALKALHSADVLHRDLKPSNLLLNANCDLKLCDFGLARSARPPPNVANDSS
TFMTEYVATRWYRAPEVMLTFKEYTRAIDIWSVGCVLAEMLSSKPLFPGRDYHHQLSIIL
DVLGTPSLDDFYAITSPRSREYIRALPFRKKKPFNTIFPTANPLALDLMEKCLTFSPKRR
IEVEDALKHPYLEAYHDPQDEPTAEPLDPSFFDFDYGEALGKEELKVLIYEEVTTPRTQS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgtagaggaccgtgcaccagcggctactaacttcatcgtaggaaacaactac
caggtcctcgatgtgatcggcgaaggtgcctatggagttgtctgctcagccctgcacatc
ccgtcggagcgcaaagtcgcgatcaagcgcataacaccgttcgaccattccatgttctgt
ctgcgtacattacgcgagatcaagctcctaaggcattttcatcacgagaatatcatctcg
atcttggacatcctgcgcccacccagccttgccgacttcaaggaggtctatctcgtgcag
gagctcatggaaacggatctccaccgcgtcatacgcacgcaagagctcagcgacgatcac
tgtcagtacttcatttatcagactctgcgagccctcaaagccctccactctgccgatgtg
ttgcatcgcgatctcaaaccttctaatctactcttgaatgccaactgcgacttgaagcta
tgtgacttcggtctggcccgctcggctcgaccacctccaaatgtcgccaacgatagcagt
acctttatgacagaatacgttgccacaaggtggtaccgtgctccggaagtcatgctgact
ttcaaggaatatacccgtgcgattgatatctggagtgtgggctgcgtactcgcggaaatg
ctcagttcgaagcctttgttccctggtcgagactaccatcaccaactgtcgattattctc
gacgtgctaggaacaccgtccctagatgatttctacgcgatcacgtcgccgcgatcgcga
gaatacatccgcgcactgccatttaggaaaaagaagccgttcaacaccattttcccaacc
gcaaacccgttggcccttgaccttatggagaaatgtctgacgttcagcccgaaaaggcga
atcgaggtcgaggacgctctgaaacacccttatttagaggcatatcacgacccacaagac
gagccaacggcagaaccgctggacccgtcgttcttcgatttcgattacggcgaagcgctt
ggtaaggaagaactgaaagtcctgatttacgaggaggttacaacaccgcgaacgcagtca
taa

DBGET integrated database retrieval system