KEGG   Postia placenta: POSPLDRAFT_116648Help
Entry
POSPLDRAFT_116648 CDS       T01162                                 

Definition
mitogen activated protein kinase-like protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 360 aa AA seqDB search
MPDVEDRAPAATNFIVGNNYQVLDVIGEGAYGVVCSALHIPSERKVAIKRITPFDHSMFC
LRTLREIKLLRHFHHENIISILDILRPPSLADFKEVYLVQELMETDLHRVIRTQELSDDH
CQYFIYQTLRALKALHSADVLHRDLKPSNLLLNANCDLKLCDFGLARSARPPPNVANDSS
TFMTEYVATRWYRAPEVMLTFKEYTRAIDIWSVGCVLAEMLSSKPLFPGRDYHHQLSIIL
DVLGTPSLDDFYAITSPRSREYIRALPFRKKKPFNTIFPTANPLALDLMEKCLTFSPKRR
IEVEDALKHPYLEAYHDPQDEPTAEPLDPSFFDFDYGEALGKEELKVLIYEEVTTPRTQS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgtagaggaccgtgcaccagcggctactaacttcatcgtaggaaacaactac
caggtcctcgatgtgatcggcgaaggtgcctatggagttgtctgctcagccctgcacatc
ccgtcggagcgcaaagtcgcgatcaagcgcataacaccgttcgaccattccatgttctgt
ctgcgtacattacgcgagatcaagctcctaaggcattttcatcacgagaatatcatctcg
atcttggacatcctgcgcccacccagccttgccgacttcaaggaggtctatctcgtgcag
gagctcatggaaacggatctccaccgcgtcatacgcacgcaagagctcagcgacgatcac
tgtcagtacttcatttatcagactctgcgagccctcaaagccctccactctgccgatgtg
ttgcatcgcgatctcaaaccttctaatctactcttgaatgccaactgcgacttgaagcta
tgtgacttcggtctggcccgctcggctcgaccacctccaaatgtcgccaacgatagcagt
acctttatgacagaatacgttgccacaaggtggtaccgtgctccggaagtcatgctgact
ttcaaggaatatacccgtgcgattgatatctggagtgtgggctgcgtactcgcggaaatg
ctcagttcgaagcctttgttccctggtcgagactaccatcaccaactgtcgattattctc
gacgtgctaggaacaccgtccctagatgatttctacgcgatcacgtcgccgcgatcgcga
gaatacatccgcgcactgccatttaggaaaaagaagccgttcaacaccattttcccaacc
gcaaacccgttggcccttgaccttatggagaaatgtctgacgttcagcccgaaaaggcga
atcgaggtcgaggacgctctgaaacacccttatttagaggcatatcacgacccacaagac
gagccaacggcagaaccgctggacccgtcgttcttcgatttcgattacggcgaagcgctt
ggtaaggaagaactgaaagtcctgatttacgaggaggttacaacaccgcgaacgcagtca
taa

DBGET integrated database retrieval system