KEGG   Postia placenta: POSPLDRAFT_120395Help
Entry
POSPLDRAFT_120395 CDS       T01162                                 

Definition
candidate alpha-galactosidase from glycoside hydrolase family GH27
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppl  Postia placenta
Pathway
Galactose metabolism
Glycerolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ppl00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 438 aa AA seqDB search
MLSTLATVLSLSLSLPSALGHDNGLALTPQMGWNTWNYFGCDVSEDTIVSAAKAMIQYDL
PKYGYEYVISDDCWQAPDRNATTGAPIADPTKFPSGMAAVADQVHLLGLKFGIYSSAGLY
TCGGHFGSLGYETIDAQTYAEWGADYLKYDNCYNEGQAGTPKLSYDRYANMSLALNATGR
TILYSMCNWGEDGPWNFAPTIANSWRISGDIYDNYNRFDERCPCLSMIDCKLAGYHCAMT
RIIDFAAPVGQKAGVNHWNDLDMLEIGNGGMTYDEYVTHFSMWSVLKSPLILGNDVTNMT
NETLEIITNDAVIAINQDPNGSAANRLWKVPVASGGDLSLWSGSLVNNQFVIALLNTSPD
TQVVDVEFTDVFIDQGPSYQTGTFTIYDLWQKNDTGAWGNDIGTFTGSIPQVEIGTHQVR
IWKAVPASTATKRDRMDL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctctccactcttgcgaccgtgctctcgctctcgctgagtcttccctctgctttggga
cacgacaatggtttagcactcacgccccaaatgggctggaacacatggaattactttgga
tgtgacgtctctgaggacactattgtgagcgcggcgaaagccatgattcaatacgacctt
ccaaaatatggctacgagtatgtcatttcggatgattgctggcaggcacctgatcgcaat
gcaaccactggtgcacctatcgctgacccaactaagtttccgtccggcatggcagcagtc
gcagatcaggtccatttactgggattgaagttcggcatttatagtagtgctggattgtac
acttgcggtggtcacttcggctccttaggctacgagaccattgatgcacagacgtacgct
gagtggggcgccgattacttgaaatatgacaactgctacaatgagggccaagcgggcacg
cccaagctctcatacgatcgctacgccaacatgtcactcgcgctcaatgctactgggcgc
acaatcctgtactctatgtgtaactggggcgaagatggcccttggaactttgctcccaca
atcgcaaacagctggcgcatctcgggggacatctatgataattacaatcggttcgacgag
cgctgcccttgcctgtcaatgattgactgcaagcttgctggatatcattgtgccatgacg
cgcattatcgattttgccgcacccgttggtcagaaggctggcgtgaatcattggaacgac
ctcgacatgcttgagatcggtaatggcgggatgacgtacgatgaatatgtcacgcacttc
tcaatgtggagtgtcctgaaaagccctctcattcttggtaacgatgttacaaacatgacc
aacgagactctggagatcatcacgaatgacgcagtcattgccatcaaccaggatccaaac
ggatctgccgcgaatcgactgtggaaggtcccagtcgcgtccggtggtgacctttcactt
tggtcaggtagcttagtgaacaaccaatttgtcatcgcgctattaaacacctcgccggat
acgcaagtcgtggatgtggaatttactgatgtcttcatcgaccagggtccatcataccaa
actggcacgtttaccatctacgacctctggcaaaagaacgataccggtgcatgggggaac
gatatcggaactttcactgggtcgatccctcaagtagagataggcacacaccaggttcgg
atctggaaggcggtacctgcgagtactgctactaagcgtgatcgtatggacttgtaa

DBGET integrated database retrieval system