KEGG   Postia placenta: POSPLDRAFT_120395Help
Entry
POSPLDRAFT_120395 CDS       T01162                                 

Definition
candidate alpha-galactosidase from glycoside hydrolase family GH27
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppl  Postia placenta
Pathway
Galactose metabolism
Glycerolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    POSPLDRAFT_120395
  Lipid metabolism
   00561 Glycerolipid metabolism
    POSPLDRAFT_120395
   00600 Sphingolipid metabolism
    POSPLDRAFT_120395
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    POSPLDRAFT_120395
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     POSPLDRAFT_120395
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 438 aa AA seqDB search
MLSTLATVLSLSLSLPSALGHDNGLALTPQMGWNTWNYFGCDVSEDTIVSAAKAMIQYDL
PKYGYEYVISDDCWQAPDRNATTGAPIADPTKFPSGMAAVADQVHLLGLKFGIYSSAGLY
TCGGHFGSLGYETIDAQTYAEWGADYLKYDNCYNEGQAGTPKLSYDRYANMSLALNATGR
TILYSMCNWGEDGPWNFAPTIANSWRISGDIYDNYNRFDERCPCLSMIDCKLAGYHCAMT
RIIDFAAPVGQKAGVNHWNDLDMLEIGNGGMTYDEYVTHFSMWSVLKSPLILGNDVTNMT
NETLEIITNDAVIAINQDPNGSAANRLWKVPVASGGDLSLWSGSLVNNQFVIALLNTSPD
TQVVDVEFTDVFIDQGPSYQTGTFTIYDLWQKNDTGAWGNDIGTFTGSIPQVEIGTHQVR
IWKAVPASTATKRDRMDL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctctccactcttgcgaccgtgctctcgctctcgctgagtcttccctctgctttggga
cacgacaatggtttagcactcacgccccaaatgggctggaacacatggaattactttgga
tgtgacgtctctgaggacactattgtgagcgcggcgaaagccatgattcaatacgacctt
ccaaaatatggctacgagtatgtcatttcggatgattgctggcaggcacctgatcgcaat
gcaaccactggtgcacctatcgctgacccaactaagtttccgtccggcatggcagcagtc
gcagatcaggtccatttactgggattgaagttcggcatttatagtagtgctggattgtac
acttgcggtggtcacttcggctccttaggctacgagaccattgatgcacagacgtacgct
gagtggggcgccgattacttgaaatatgacaactgctacaatgagggccaagcgggcacg
cccaagctctcatacgatcgctacgccaacatgtcactcgcgctcaatgctactgggcgc
acaatcctgtactctatgtgtaactggggcgaagatggcccttggaactttgctcccaca
atcgcaaacagctggcgcatctcgggggacatctatgataattacaatcggttcgacgag
cgctgcccttgcctgtcaatgattgactgcaagcttgctggatatcattgtgccatgacg
cgcattatcgattttgccgcacccgttggtcagaaggctggcgtgaatcattggaacgac
ctcgacatgcttgagatcggtaatggcgggatgacgtacgatgaatatgtcacgcacttc
tcaatgtggagtgtcctgaaaagccctctcattcttggtaacgatgttacaaacatgacc
aacgagactctggagatcatcacgaatgacgcagtcattgccatcaaccaggatccaaac
ggatctgccgcgaatcgactgtggaaggtcccagtcgcgtccggtggtgacctttcactt
tggtcaggtagcttagtgaacaaccaatttgtcatcgcgctattaaacacctcgccggat
acgcaagtcgtggatgtggaatttactgatgtcttcatcgaccagggtccatcataccaa
actggcacgtttaccatctacgacctctggcaaaagaacgataccggtgcatgggggaac
gatatcggaactttcactgggtcgatccctcaagtagagataggcacacaccaggttcgg
atctggaaggcggtacctgcgagtactgctactaagcgtgatcgtatggacttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system