KEGG   Postia placenta: POSPLDRAFT_125584Help
Entry
POSPLDRAFT_125584 CDS       T01162                                 

Definition
mitogen activated protein kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ppl  Postia placenta
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    POSPLDRAFT_125584
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     POSPLDRAFT_125584
Protein kinases [BR:ppl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   POSPLDRAFT_125584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 372 aa AA seqDB search
MSFVKLSIFGTSFEVTTRYVDLQPVGMGAFGLVCSAKDQLTGSSVAIKKIMKPFSTPVLS
KRTYRELKLLKHIQHENIISLSDVFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYF
LYQILRGLKYVHSAGVVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRA
PEIMLTWQKYDVAVDIWSAGCIFAEMLEGKPLFPGKDHVHQFSIITELLGTPPEDVIQTI
ASENTLRFVQSLPKRERVPFSEKLTCKDPVAIDLLEKMLVFDPRKRITATESLSHEYVAP
YHDPTDEPEAGEKFDWSFNDADLPVDTWKVMMYSEILDFHQVGDSRLNEGVPEGALAAPE
DPAAASVAATAE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgtcaagctcagcatatttggtacctccttcgaggttacaacccgctatgtt
gacttacaacccgttggaatgggcgcgtttggtctcgtctgctccgcaaaggaccagctc
acaggctcatccgtcgcgatcaagaagatcatgaagcccttcagcactcccgtcctctct
aaacgtacataccgtgaactcaagctcctcaaacatatccaacatgagaacatcatcagt
ctcagcgacgtcttcatttccccactagaggacatctacttcgttacagagctactcggc
acggatctccatcgtcttctaacctcgcgtccactcgagaagcaattcatccaatacttc
ctctaccagatcctgcgaggtctcaaatacgttcattcggctggtgtcgtgcaccgtgat
ctcaaaccgagcaatatcctgatcaatgagaattgtgacctcaagatctgtgatttcggc
ctggcgcgcattcaggacccacaaatgacgggctatgtctcgacgcggtactatcgtgca
cctgagatcatgctcacatggcagaagtacgatgtcgcggtggatatctggagtgctggg
tgcatctttgctgagatgctcgagggcaagccgcttttccctggcaaggaccacgtacac
cagttctcgatcatcactgagctccttggtacaccgccagaagacgtcattcagacgatc
gccagtgagaacacactccgttttgtacaaagcctgccgaaacgcgaacgcgtgccgttt
agcgagaaactcacgtgcaaggaccccgttgcgatcgatctgcttgagaagatgctcgtt
ttcgacccgcggaagcgtatcaccgcgacggagtcgctctcgcacgagtacgtcgcgccg
taccatgacccaacggatgagccggaagctggggagaagttcgactggagcttcaacgat
gcggacctgcccgtggacacgtggaaggtcatgatgtacagcgagatcctcgatttccac
caggtcggtgattcacgattgaacgaaggcgtaccagagggtgcgctcgcagcaccagaa
gaccctgctgccgcatccgtcgctgcgacagcagaatag

DBGET integrated database retrieval system