KEGG   Postia placenta: POSPLDRAFT_134783Help
Entry
POSPLDRAFT_134783 CDS       T01162                                 

Definition
endo-1,4-B-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ppl  Postia placenta
Brite
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     POSPLDRAFT_134783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 366 aa AA seqDB search
MTLTPALLAFAACLPVLANGLPQAASSASTALPTSTAVVPGLNDLAISAGKRYFGSATDN
PELNDTTYTSILENYAMFGQITPGNSMKWYATEPEPGVFTFTAGNVIADLAKSNGMVLRG
HNCVWYEELPDWVTANNYNATELAAIVANHTGTLVGYYAGQMYAWDVINEPLNDNGTMRE
DIFYDTLGDSYISIALKAARAADPNVKLYINDYNIEYVGTKSTAMQNLIKQLQADDVPID
GVGLESHFIVGEVPTTIVENMQAFAALGLEFAITELDIRMELPATADLYEQQKTDYYTVV
SACMQVEQCVGITVWDWTDKYSWIPSTFPGYGDACPWDSNDMLAHQNYERKPAFDGIAIA
LQGQSI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcactccagctctacttgccttcgcggcgtgtctccctgtcctagcgaatggt
ctaccgcaggccgcttcttccgcaagcactgcgctgcctacttcaacggccgtcgtaccc
ggcttgaatgacctagccatcagtgcggggaaacgctacttcggctctgctacggacaat
ccggagctcaatgatacgacgtacacctccatcttggagaattatgccatgttcggccag
atcactccgggaaacagtatgaaatggtatgccacagagcctgagccgggagtcttcact
ttcacagccggcaatgtcatcgcggatctcgcgaagtccaacggcatggtgctgagagga
cacaactgcgtatggtatgaagagcttccggactgggtaacggctaacaactacaatgcg
actgagcttgccgccatcgtcgccaaccacaccggtacgctggtagggtactacgcaggt
caaatgtatgcatgggatgtcatcaatgagccactcaatgacaatggcacaatgcgcgag
gacatcttctacgacacgcttggagatagctatatttcaatcgcgctgaaggccgcacgc
gcagctgacccgaacgtgaagctttacatcaacgattacaacattgaatacgtcggcacg
aaatcgacggcaatgcagaacctcatcaagcagttacaggcggacgacgtaccaattgat
ggcgtcggtctggagagccatttcatcgttggcgaagtgcccacgacgatcgtggagaac
atgcaggcatttgccgcgctcggactggagttcgcaatcacagagctcgacattcgtatg
gaactcccggcaactgctgatctgtacgagcagcagaagacggactactatactgtcgtg
tcggcgtgtatgcaggttgaacaatgtgtcggtatcactgtctgggactggactgacaag
tattcgtggatcccgtccactttccctggctacggagatgcttgcccttgggattcgaat
gacatgttggcgcatcagaactatgaaaggaaaccagcatttgatgggattgctatcgcc
ttgcagggtcaatctatctga

DBGET integrated database retrieval system