KEGG   Postia placenta: POSPLDRAFT_134803Help
Entry
POSPLDRAFT_134803 CDS       T01162                                 

Definition
hypothetical lysophospholipase
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ppl  Postia placenta
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    POSPLDRAFT_134803
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     POSPLDRAFT_134803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
MATYYAPHHVSCPSESLIRQAGTPQAKNQTLHPDEKKYVRARKQIVKQSMQSWLGSNMTK
VYSGDFSKLSVDDAPNIAISVSGGNFRAALFGAASLEVFDARVRSSVDAGLGGLLQSSAY
ITALSGGSYLSTSLMFNEFPMLSDLVFGNDTLGIPGWQLDVNLFQPGPSGEYTTTFFTHL
YDDLGAKQSQGFPVTFCDFWGRALSYHFLPGTNGTESFASNTTAGNHAASLSYSSATQLQ
TWKDRTMPFPIVLIDVNSPQAQGNAFGDTGVLPLTSVVYELTPFEFGSYDPQLAAFVELP
YLGSTFHGGAPSSCVNSFDNAGLMIGTSSCDFHQYNVTDNVYWKAEFEPLIANLTKVFGQ
HQPGQEMDVTSVANPFYGMHAGTYQDAQETNLSLLDGSLDVENDPVLPLLVKARGLDAVI
VLDSSGETNDLKPSGLSLLATKEKAAVLPSGTINFPTPFPNSTDEFISKGLNVRPVFFGC
EGPTKQEEAFP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttactacgccccccatcatgtgagctgccccagcgagagcctcatccggcag
gctggtacaccgcaggcaaaaaatcagactttgcatccggacgagaaaaagtacgttcgg
gctcgcaagcagattgtcaagcagagcatgcagagctggctaggttccaacatgaccaaa
gtgtacagtggcgacttctccaagctctcggtggacgacgcgccgaatatcgccatctct
gtatctggcggcaacttccgcgcagcgcttttcggtgcggcgtcgttggaggtgttcgat
gctcgggtgcgtagcagcgtagatgcaggccttggcgggcttctccagtcctctgcgtac
atcacagcattgtcaggagggtcatatttatcaacaagtcttatgtttaacgagttcccc
atgctctccgaccttgtctttggcaatgatacactgggcatccctggttggcagctggat
gtgaacctcttccaaccagggccgtccggtgaatatactaccaccttcttcactcacctt
tacgacgacctgggtgcaaagcagtcccagggctttccagtaacgttttgtgacttctgg
ggacgcgcactctcttatcacttccttccggggacgaacggaaccgaatcgtttgcatcc
aacacgactgcaggaaaccatgcagcgagtttgtcctattcctctgcaacacagctgcaa
acatggaaagaccggaccatgccgttccccatcgtgctcatagacgtcaattcgcctcaa
gcacagggcaatgcgtttggcgacacgggcgtcctgccactcaccagcgttgtatacgag
ctgacgccattcgaatttggatcttacgatcctcagctcgccgcgttcgtcgagctacct
taccttggctcgacgttccatggcggcgcgccgtcatcctgcgtgaacagcttcgacaat
gcggggctcatgattggcacgtcgtcgtgcgactttcaccagtacaacgtcacggacaac
gtctactggaaggccgagttcgagcccctgatcgcgaacctgacgaaggtgttcggtcag
caccagcctgggcaagaaatggacgtgacgagcgttgcgaacccgttctatgggatgcac
gcaggcacgtaccaggacgcacaggagacaaacctgagcctgctagatggctcgctggac
gtggagaatgaccccgtgctgccgctgctagtaaaggcaagagggctggacgccgtgatt
gtcctcgactcgtccggagagaccaatgacttgaagccttccgggctatcgctgctcgcg
acaaaagagaaggctgctgtccttccatctggaacaatcaacttccctacgccgttccct
aactcgacggacgagtttatctccaaggggctgaacgtacgcccagtatttttcgggtgc
gaggggccgaccaaacaggaagaggcgttcccg

DBGET integrated database retrieval system