KEGG   Postia placenta: POSPLDRAFT_134815Help
Entry
POSPLDRAFT_134815 CDS       T01162                                 

Definition
eukaryotic translation initiation factor 4E class I
Orthology
K03259  
translation initiation factor 4E
Organism
ppl  Postia placenta
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    POSPLDRAFT_134815
Translation factors [BR:ppl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    POSPLDRAFT_134815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 303 aa AA seqDB search
MSSVSGLPAPALQASQAAINAALAENEIKENGRANGDEAEPGEIQEVDMQQQAENIRTVF
NDPTNFNVKHPLYSPWTLWFDSPATKGRNLPQTPMSSFPQTPLLQTPGAAAAQGWMEDIK
RVISFDSVEEFWGLYNNIVPPSQLPQKANYYLFKEGIIPAWEDEANKNGGKWSIQLPKDK
NRNNVDRMWLYTMLAAIGETFDPLLSNPDAETPSQSLITGVIVSTRPQFYRLSIWTRIAP
TGAGGDDDKLRERIESVGRHFKMNVLGYSDSQKLSGPLATEVEFQSHKDSEKKGKQSGRK
IVV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgtatctggtctgcccgcgcccgctcttcaggcctcgcaagcggccatcaat
gccgcgttggctgagaatgagattaaagagaacggaagggcgaatggcgacgaggcagag
cctggcgagatccaggaggtagacatgcagcagcaagcagagaacatccgcacggtcttc
aatgacccaaccaactttaatgtcaagcatcctctctactcaccatggaccctctggttt
gattcccccgcaacaaaaggccgcaaccttccccagactcccatgtcgtcatttcctcag
acccccctactccaaacccccggtgctgcggcagcacaaggctggatggaggatatcaaa
cgagtgattagttttgatagcgttgaagagttctggggattgtacaacaacattgttcct
ccatcacaactgccgcaaaaggcgaactactacctcttcaaggagggtatcattcctgcg
tgggaggacgaggccaacaaaaacgggggcaagtggagcattcagcttccgaaagacaag
aaccgaaacaatgtcgacagaatgtggctgtatacgatgctggccgccattggcgagaca
ttcgatcctttgttgtcaaacccggacgcagaaacgccttcccagtcgttgatcactggt
gtcattgtttccacgcggccgcagttctaccgactgtccatatggacacgcattgcgccg
acaggagcaggcggtgatgatgacaagctgcgcgagcggatcgagtcggttggacgacat
ttcaagatgaacgtgttaggatattcagactcgcagaagctgtctggccctctagcgacg
gaggtagagtttcagtcacacaaggactcggagaagaaagggaaacagtcgggcaggaag
attgttgtctaa

DBGET integrated database retrieval system