KEGG   Postia placenta: POSPLDRAFT_134827Help
Entry
POSPLDRAFT_134827 CDS       T01162                                 

Definition
(GenBank) eukaryotic translation initiation factor 4E class I
  KO
K03259  translation initiation factor 4E
Organism
ppl  Postia placenta
Pathway
ppl03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    POSPLDRAFT_134827
Messenger RNA biogenesis [BR:ppl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     POSPLDRAFT_134827
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     POSPLDRAFT_134827
Translation factors [BR:ppl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    POSPLDRAFT_134827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-ProteinID: EED82407
JGI: 134827
UniProt: B8P9S7
AA seq 303 aa AA seqDB search
MSSVSGLPAPALQASQAAINAALAENEIKENGRANGDEAEPGEIQEVDMQQQAENIRTVF
NDPTNFNVKHPLYSPWTLWFDSPATKGRNLPQTPMSSFPQTPLLQTPGAAAAQGWMEDIK
RVISFDSVEEFWGLYNNIVPPSQLPQKANYYLFKEGIIPAWEDEANKNGGKWSIQLPKDK
NRNNVDRMWLYTMLAAIGETFDPLLSNPDAETPSQSLITGVIVSTRPQFYRLSIWTRIAP
TGAGGDDDKLRERIESVGRHFKMNVLGYSDSQKLSGPLATEVEFQSHKDSEKKGKQSGRK
IVV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgtatctggtctgcccgcgcccgctcttcaggcctcgcaagcggccatcaat
gccgcgttggctgagaatgagattaaagagaacggaagggcgaatggcgacgaggcagag
cctggcgagatccaggaggtagacatgcagcagcaagcagagaacatccgcacggtcttc
aatgacccaaccaactttaatgtcaagcatcctctctactcaccatggaccctctggttt
gattcccccgcaacaaaaggccgcaaccttccccagactcccatgtcgtcatttcctcag
acccccctactccaaacccccggtgctgcggcagcacaaggctggatggaggatatcaaa
cgagtgattagttttgatagcgttgaagagttctggggattgtacaacaacattgttcct
ccatcacaactgccgcaaaaggcgaactactacctcttcaaggagggtatcattcctgcc
tgggaggacgaggccaacaaaaacgggggcaagtggagcattcagcttccgaaagacaag
aaccgaaacaatgtcgacagaatgtggctgtatacgatgctggccgccattggcgagaca
ttcgatcctttgttgtcaaacccggacgcagaaacgccttcccagtcgttgatcactggt
gtcattgtttccacgcggccgcagttctaccgactgtccatatggacacgcattgcgccg
acaggagcaggcggtgatgatgacaagctgcgcgagcggatcgagtcggttgggcgacat
ttcaagatgaacgtgttaggatattcagactcgcagaagctgtctggccctctagcgacg
gaggtagagtttcagtcacacaaggactcggagaagaaagggaaacagtcgggcaggaag
attgttgtctaa

DBGET integrated database retrieval system