KEGG   Postia placenta: POSPLDRAFT_134983Help
Entry
POSPLDRAFT_134983 CDS       T01162                                 

Definition
eukaryotic translation initiation factor 4E class II
Orthology
K03259  
translation initiation factor 4E
Organism
ppl  Postia placenta
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ppl03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 265 aa AA seqDB search
MAGYFSNHSQSRFLANSNSTSSATQTTVAPTPSPAPRPRVPSSKHFSTSLSTSSADEKSP
NKDKPSASASRNASPVVHPLRHTWVFWFRQQRGPGTKITNYEEGIKKVSAFSSVESFWSL
WTHLHSPSALLPTTDYLLFHSGVRRPVWEDPLNLPGGKWIIRLRKGIADRLWEDLVLAVV
GDQFAEWPEICGCTISVRQNEDIISVWNRHDSDAQVKEKVKETIWRVLNLPPTTVMEYKS
NNDSMQDKSSFRVPASVSVDRTPQS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctggctacttttccaaccactcccagtcccgcttcctcgcaaactccaattctacc
tcctccgcaacccagacgaccgtggctccgacaccctcacccgcaccgcgtccccgcgtg
ccctcgtcaaagcacttttccacatcactatccacctcctccgccgacgaaaagtccccg
aacaaggacaaaccctccgccagcgcaagccgcaacgcgagccccgtcgtgcatcccctc
cgccatacctgggtattctggttccgccagcagcgcggtcccggcacaaaaatcacaaac
tacgaggagggcatcaagaaggtctctgcgtttagctcggtcgagtccttctggtccctc
tggacacacctccactcgccgtccgccctccttcccaccaccgactatctcctcttccac
tctggcgtccgccgtcccgtctgggaggaccctcttaacctccccggcggcaagtggata
atccgtctccgcaagggcattgcggaccgcctttgggaggacctcgtcctcgctgtcgtt
ggcgaccagttcgccgagtggcccgaaatctgcgggtgcacgattagtgtgcgtcagaac
gaggacatcatctccgtctggaaccgccatgactcggatgctcaggtaaaggagaaagta
aaagaaacaatttggcgggtgctcaacctcccaccaacaaccgtcatggagtacaagtca
aacaatgactccatgcaagacaagtcgagcttccgggtacctgccagcgtaagcgtagat
cgcacaccgcagtcatga

DBGET integrated database retrieval system