KEGG   Postia placenta: POSPLDRAFT_21062Help
Entry
POSPLDRAFT_21062  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 484 aa AA seqDB search
AQNSDESKVLIINTGGTINMILGQKGYEPEPYFLTETLRSQNRFHDPLGDSLFSHSSSAH
LPSLITPRSKTPGGIQKRIRYAILEWDPLLDSSNIEIHDWIRIATDIELNYSTFDAFVIL
HGTDTMSYTSSALSFLLEDLGKTVILTGAQIPLSQLRNDAIDNLLGALVIAGHYIIPECC
LFFNHTLFRGNRVSKLSSYDLNAFNSPNFPPLVNVGIDIMVNWNDVIRQTSLRRFCAHKS
EPPVSTLRLFPGITAATIRAFLTPPTQGVVLEAFGAGNAPQRPDLIGALKDACDRGVVIV
SISQCAKGSVSDAYAAGRELLIAGVVSGGDMTPECALTKLSYLLSKPELSAAEVRSLIGT
PLRGELTRPASALPPSLSEPKGIEQSLENIQGVLSQVVRLPGSEPRRRNIAIAGGLVNSI
EPASGRSPLHSAALNGNVNAVNSLLEAGALVHLRDVLGHTPLYYAARQAHEAVVEVLVKA
GALL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gcacagaactcggatgagtccaaagtgctcataatcaacactggcgggacaatcaacatg
atcctcgggcagaaaggctatgagcccgaaccatacttcttgacagaaacacttcgcagc
caaaaccgcttccacgatccgctcggggattcgctattctcgcattcatcctccgcacat
ctaccaagtttgattaccccgcgaagtaaaacgcctggtggaattcagaaacgcattcgt
tatgccattctcgagtgggatcccctactagacagcagcaacatagagatccacgattgg
atcaggatagccacagacatagagctaaactactctacatttgatgccttcgtcatcttg
cacggaacggacactatgtcgtacacctcgtccgccctcagctttttactcgaggatcta
ggcaagactgtgatccttaccggtgctcagataccgctgtctcaactcaggaacgacgcg
atagacaacctcttgggcgcgctagtgatcgccggccattacatcatcccagaatgctgc
ctattcttcaatcacaccctgttcaggggcaatagagtctcaaagctctcatcgtacgac
cttaatgctttcaatagccctaatttcccgccgcttgtgaatgttggcattgacatcatg
gtcaattggaacgatgtaatacgacagacaagccttcgacgtttctgtgcacacaaaagt
gagcctcccgtctccactctgcgtctattcccgggaattacagcagccaccattcgagca
ttccttacacccccgacacagggtgtggtcttggaggcgttcggcgccggaaatgcgcca
caacgccccgacctgatcggcgcgctcaaagatgcctgtgaccggggtgtagtgatcgtc
tccatttcgcagtgtgcgaagggctccgtctcggacgcatatgcggcagggcgggaactc
ctcatagctggggtggtctccgggggtgacatgacacccgagtgtgcgcttaccaaactg
agttacctcctttccaagccagagctctccgcagccgaagtgcgctcgctcatcggtacg
cccctgcgcggagaactcacccgccctgcgagcgcactcccgccaagcctcagcgagcct
aaggggatcgagcaaagtctagaaaacatccagggcgtgctctcacaggttgtccgcctc
ccgggttccgagccgcggcggcgcaacatagccatcgcgggagggctggtcaacagcatc
gagcctgcctcggggcgttcgccgttgcattctgctgcgctgaacgggaacgtcaacgcg
gtcaacagtctcctcgaagctggtgcgctggtgcatctccgagacgttctcggacacacg
ccactgtattatgctgcgcggcaggcacacgaggctgtcgtcgaggtgctggtaaaggcg
ggagcactcctg

DBGET integrated database retrieval system