KEGG   Postia placenta: POSPLDRAFT_40102Help
Entry
POSPLDRAFT_40102  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 405 aa AA seqDB search
HSRPIVSYYFPKGVGEQHYGERHPMKPHRLTLTNTLVTGYGLDKQIHNIYNPRSATQAEL
EVYHDHDYIEFLSRVTPQNQADMKHLIDTFNCVEDCPIFADMYDFCRMYAGASLAAARKL
CAGTTDIAINWSGGLHHAKKGEASGFCYVNDIVLAILELLRYHPRVLYIDIDIHHGDGVE
FAFYHTNRVMTVSFHKYTGDFFPGTGKLDDNGAGLGKHFCLNVPLQDGIDDNMYLTIFKT
VIEDTVTAFRPTAIVLQCGADSLGCDRLGAFNLSIAAHGECVNFVRKFGVPLLVVGGGGY
TIKNVSRCWTYETSVLVGAAIPDELPVTIYDSFFRESQWKLHPPLTGKVENQNTVASLQR
ITTGIRNKLRYLQGAPSVALQEIPPDLAGWLEDESRTREEKIEEK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
cattcgcgacccattgtttcatactacttcccgaagggggttggcgaacagcactatggt
gaacgacatcccatgaagccccatagattgacgctcacgaacacgctcgttacgggctat
ggtcttgacaagcaaatccataacatatataaccctcgttcagcaacccaagccgaactc
gaagtataccatgaccacgattatatcgaattcctgtctagagtcactccgcagaaccaa
gctgacatgaagcacctcatcgatactttcaactgcgtggaggattgcccgatctttgcg
gatatgtatgacttctgtcgtatgtacgctggcgcctcccttgcagcggccagaaagctt
tgcgccgggacaactgacatcgccatcaattggtccggtgggctacatcacgcaaagaaa
ggcgaggcaagtggattctgctacgtgaacgatattgtccttgctatcttagagcttttg
agatatcatcctcgagtcctatatattgacattgacatccatcatggcgacggggtggaa
ttcgctttctatcacacgaaccgcgtcatgactgtctcctttcacaaatacactggcgac
tttttcccgggtacagggaagctggacgacaacggtgctggtctcggcaagcacttctgc
ctgaacgtccccctgcaagatgggattgacgacaatatgtaccttacaatcttcaagact
gtcatcgaagacaccgtcacagctttcagacccacggccattgtcctgcagtgtggcgca
gactctctgggttgcgatcgactaggcgcgttcaacctgtccatcgcagcgcacggggag
tgtgtcaactttgttcgcaaattcggcgtcccgcttctagtcgttggcggcggcggctac
accattaaaaatgttagccgctgctggacgtatgagacttctgtcctagtcggcgccgct
atcccagacgaattacctgtcaccatatacgattccttcttcagagagtcgcaatggaaa
ctacatccacccctcacaggaaaagtggagaaccagaacactgtggcatctcttcagcgc
attaccaccggtatccgcaataagcttcgatatcttcaaggcgcccctagtgtcgctttg
caggagattcccccagatcttgccgggtggctcgaagatgaatcgaggacacgcgaggag
aaaatagaggaaaag

DBGET integrated database retrieval system