KEGG   Postia placenta: POSPLDRAFT_40337Help
Entry
POSPLDRAFT_40337  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
ppl  Postia placenta
Brite
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     POSPLDRAFT_40337
Peptidases [BR:ppl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   POSPLDRAFT_40337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 269 aa AA seqDB search
TLLSALRSLFVHISRHPAERGSVAPRAFIDKLKELNELFRGSMHQDAHEFLNFLLNKIVE
EMEDDRRLGYPVQATIVHRLFEGVLTSETRCLTCETVSSRDESFLDLSIDIEQNSSVTAC
LRQFSASEMLCQKNKFFCDSCCDLQEAEKRMKIKKLPNILALHLKRFKYQEDVGKYIKLA
YRVAFPFQLRLFNTVDDAENPDRLYELFAIVVHIGNGPHHGHYVTIIKARGTWLLFDDDS
VDTIKESDIPKYYGESTNGSAYVLYYQAV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
acgctgctgtccgcactgcggtcgctgttcgtgcatatcagccgccatccggcagagcgc
gggtcggtggcgccgcgcgcattcatcgacaagctcaaggagctgaacgagctgttccgg
ggctcgatgcaccaggacgcgcacgagtttctgaatttcctgctgaacaagatcgtcgag
gagatggaagacgaccggaggctcgggtacccggtgcaggcgacgatcgtgcaccggctg
ttcgagggcgtgctgacgagcgagacgcgctgcctcacgtgcgagacggtgtcctcgcgg
gacgagagcttcctggatctctcgatcgacatcgagcagaactcgagcgtgacggcgtgc
ctgcggcagttcagcgcgagcgagatgctgtgccagaagaacaagttcttctgcgactcg
tgctgcgatctgcaggaggcggagaaacggatgaaaatcaagaagctgccgaatatactg
gcgctgcatctgaagcggttcaagtaccaggaggatgtgggcaagtatatcaagcttgcg
taccgcgtggcgttcccgttccagctgcgcctcttcaacaccgtggacgacgccgagaat
cctgatcggctgtacgagctgttcgcgattgtcgtgcacatcggaaacggtccccatcac
ggccactacgtcacgatcatcaaggcgcgggggacgtggctgctctttgatgatgacagt
gtcgacaccatcaaggagtccgacattccaaagtactatggcgagtctacgaatggctcg
gcgtacgtcctttattaccaggcggtc

DBGET integrated database retrieval system