KEGG   Postia placenta: POSPLDRAFT_44442Help
Entry
POSPLDRAFT_44442  CDS       T01162                                 

Definition
candidate cAMP dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ppl  Postia placenta
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    POSPLDRAFT_44442
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     POSPLDRAFT_44442
Protein kinases [BR:ppl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   POSPLDRAFT_44442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 447 aa AA seqDB search
MERPAVPVFRSTSLPSTTPRAKSAPLNLVLPDRDSPFVAGRGPITPPISPGNSEEGDPVV
IIDSEPRYSPYLGIDRDESTTEEPMDVDARPAESSPKPPLRHLEDEECHLERGTLNLTDF
EVKGTLGRTGTFSRVLLVRLRGSSSPNAQNCFALKVLRKTEIVRLRQVEHVNAERYILSR
VRHPFIVDLYATFQDSLNIYMLLSYVPGGELFTHLRRARRFTPDVTRFYLATIVLALKFL
HSYNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGK
AADWWACGILCYEMVVGYPPFFDETAYGIYEKILKGKIHWPREMDRLTKDIIKAFLHPDR
SKRLGNLTRGPQDVLDQPWFRGVDWDALERREIRAPIIPHVNSLDDTRHFSHLPLPPPEE
IPGLIKEEQPPALQQRFDPIAYQFMEF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcccgcagtccctgtcttccgctcgacgtccctgcctagtactacaccgcgg
gctaagtcggctccgctgaatctagtcctgccagaccgtgattcaccgttcgtagcgggt
agagggccgattacaccgccaatctccccgggcaatagcgaagagggtgacccagtcgtc
atcattgattcagagcctcgctacagcccttatttaggcatcgaccgcgacgagagcaca
acagaggagcccatggacgtagacgcaagaccagctgaaagctcccccaagccgcccctg
aggcatcttgaggacgaggaatgtcaccttgaacgggggacccttaaccttaccgatttt
gaagttaagggcactctaggtaggacagggacatttagtcgtgtgcttctcgtgcgcctt
cgcggctcatcgagtcccaacgcccaaaactgcttcgcactcaaggtcttgcgtaaaacc
gagatcgtgcgcctgcgacaggtcgaacacgtaaacgcggagcggtatattttatcccgc
gtccgacatccatttattgtcgacctctatgccacattccaggacagtctcaacatctac
atgttgttgtcctacgtccccggtggagaattgttcacacacctgcggagagcgcgtcgt
ttcacgccagatgtcacgcgattctacttggcgaccatcgtccttgccctcaaatttttg
cattcttacaacattatctaccgagacctgaagcctgaaaatctcttactcgactcgcgt
ggctatctgcggctcacagacttcggtttcgctaaaattgttgatgaccgtacctggact
ctctgcggaactcccgaatacctcgcacctgaaattatacagtcagacggccacggcaag
gccgccgactggtgggcctgcggtattctctgttatgaaatggtggtcgggtacccgcca
ttcttcgacgagaccgcgtacgggatctatgaaaagattttgaagggcaagattcactgg
ccgcgagaaatggataggctgaccaaggacatcatcaaagccttcctacatccggaccgt
agcaagcgtcttggtaatctcacccgtggccctcaagatgtgctagaccaaccgtggttc
cgcggcgtcgattgggacgcattggagcggcgagagattagggcccctattatcccgcat
gtcaactcccttgacgacacacgccacttctcgcaccttcccttgcccccacccgaagag
attcccggtctcataaaggaagaacagccgccggcccttcagcaacgatttgaccctatt
gcgtatcagtttatggagttctaa

DBGET integrated database retrieval system