KEGG   Postia placenta: POSPLDRAFT_44442Help
Entry
POSPLDRAFT_44442  CDS       T01162                                 

Definition
(GenBank) candidate cAMP dependent protein kinase
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ppl  Postia placenta
Pathway
ppl04113  Meiosis - yeast
ppl04138  Autophagy - yeast
Module
ppl_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    POSPLDRAFT_44442
  Cell growth and death
   04113 Meiosis - yeast
    POSPLDRAFT_44442
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     POSPLDRAFT_44442
Protein kinases [BR:ppl01001]
 Serine/threonine kinases: AGC group
  PKA family
   POSPLDRAFT_44442
Messenger RNA biogenesis [BR:ppl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     POSPLDRAFT_44442
Chromosome and associated proteins [BR:ppl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    POSPLDRAFT_44442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-ProteinID: EED79048
JGI: 44442
UniProt: B8PJA9
AA seq 447 aa AA seqDB search
MERPAVPVFRSTSLPSTTPRAKSAPLNLVLPDRDSPFVAGRGPITPPISPGNSEEGDPVV
IIDSEPRYSPYLGIDRDESTTEEPMDVDARPAESSPKPPLRHLEDEECHLERGTLNLTDF
EVKGTLGRTGTFSRVLLVRLRGSSSPNAQNCFALKVLRKTEIVRLRQVEHVNAERYILSR
VRHPFIVDLYATFQDSLNIYMLLSYVPGGELFTHLRRARRFTPDVTRFYLATIVLALKFL
HSYNIIYRDLKPENLLLDSRGYLRLTDFGFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGK
AADWWACGILCYEMVVGYPPFFDETAYGIYEKILKGKIHWPREMDRLTKDIIKAFLHPDR
SKRLGNLTRGPQDVLDQPWFRGVDWDALERREIRAPIIPHVNSLDDTRHFSHLPLPPPEE
IPGLIKEEQPPALQQRFDPIAYQFMEF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcccgcagtccctgtcttccgctcgacgtccctgcctagtactacaccgcgg
gctaagtcggctccgctgaatctagtcctgccagaccgtgattcaccgttcgtagcgggt
agagggccgattacaccgccaatctccccgggcaatagcgaagagggtgacccagtcgtc
atcattgattcagagcctcgctacagcccttatttaggcatcgaccgcgacgagagcaca
acagaggagcccatggacgtagacgcaagaccagctgaaagctcccccaagccgcccctg
aggcatcttgaggacgaggaatgtcaccttgaacgggggacccttaaccttaccgatttt
gaagttaagggcactctaggtaggacagggacatttagtcgtgtgcttctcgtgcgcctt
cgcggctcatcgagtcccaacgcccaaaactgcttcgcactcaaggtcttgcgtaaaacc
gagatcgtgcgcctgcgacaggtcgaacacgtaaacgcggagcggtatattttatcccgc
gtccgacatccatttattgtcgacctctatgccacattccaggacagtctcaacatctac
atgttgttgtcctacgtccccggtggagaattgttcacacacctgcggagagcgcgtcgt
ttcacgccagatgtcacgcgattctacttggcgaccatcgtccttgccctcaaatttttg
cattcttacaacattatctaccgagacctgaagcctgaaaatctcttactcgactcgcgt
ggctatctgcggctcacagacttcggtttcgctaaaattgttgatgaccgtacctggact
ctctgcggaactcccgaatacctcgcacctgaaattatacagtcagacggccacggcaag
gccgccgactggtgggcctgcggtattctctgttatgaaatggtggtcgggtacccgcca
ttcttcgacgagaccgcgtacgggatctatgaaaagattttgaagggcaagattcactgg
ccgcgagaaatggataggctgaccaaggacatcatcaaagccttcctacatccggaccgt
agcaagcgtcttggtaatctcacccgtggccctcaagatgtgctagaccaaccgtggttc
cgcggcgtcgattgggacgcattggagcggcgagagattagggcccctattatcccgcat
gtcaactcccttgacgacacacgccacttctcgcaccttcccttgcccccacccgaagag
attcccggtctcataaaggaagaacagccgccggcccttcagcaacgatttgaccctatt
gcgtatcagtttatggagttctaa

DBGET integrated database retrieval system