KEGG   Postia placenta: POSPLDRAFT_46675Help
Entry
POSPLDRAFT_46675  CDS       T01162                                 

Definition
mitogen activated protein kinase-like protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 382 aa AA seqDB search
MPEQAQPAAAKSKHSHAASQAQPAPRKVRFNVGSQYQVLDVVGEGAYGIVCSAVHRPSGR
KVAIKKIAPFDHSMFCLRTLRELKLLKFLSEAGVSENIISILDIIKPPSIDQFKEVYLIQ
ELMETDMHRVIRTQDLSDDHAQYFIYQTLRALKALHSADVIHRDLKPSNLLLNANCDLKV
CDFGLARSVKTAEPSGTETGFMTEYVATRWYRAPEIMLTFKQYTKAIDIWSVGCILAEML
SGKPLFPGRDYHHQLTLILDVLGTPTLDEFYAITTRRSRDYIRALPFRKRKPFAQLFPNA
NPLAVDFLTRSLTFDPKKRITVEEALAHPYLEAYHDPEDEPVAPPLDPEFFEFDLHKDDI
SREQLKELLYDEIMSFRPPPMV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcaagcccaacctgcagctgcgaagtcgaagcatagtcatgcggcgtcgcag
gcgcagcccgcaccgcgcaaggtccgcttcaacgtcggatcgcaatatcaggtcctagat
gtcgtcggcgagggggcatacggtatcgtctgctctgcagtacaccgacctagtgggcgc
aaggtcgccatcaagaagatcgcgccgttcgaccactcgatgttttgcttgcggacgctg
agagagctgaagctgttgaagttcttgagtgaggcgggggtcagcgaaaatatcatctca
atcctagacatcatcaagccaccatcgatagatcagtttaaggaagtgtatttgatccaa
gaactcatggaaaccgacatgcaccgcgtcatacgtacacaggacctctccgacgaccac
gcacaatacttcatttaccaaaccctccgggcgctcaaggcgctacattccgccgacgtc
attcaccgtgacctcaaaccgtctaacctgctgttgaatgcgaactgcgacctcaaggtg
tgcgacttcgggctggcccgctccgtgaagaccgcggaaccctcgggcacggaaacgggc
ttcatgaccgaatacgtcgctacacggtggtaccgcgcgcccgagatcatgctcacgttc
aagcagtacaccaaggcgatcgacatctggtctgtcggctgcatccttgcggagatgctg
tcgggcaagccgcttttcccggggcgcgactaccaccaccagctgacacttatcctcgac
gtcctcggcacgccgacgctcgacgagttctatgcgatcacgacccgccgctcgcgcgac
tacatccgcgctttgcccttccgcaagcgcaagccattcgcgcagcttttcccgaacgca
aatccgctcgcggtcgacttcctcacgcgtagcttgacgttcgaccccaaaaagcgtatc
acggttgaggaggcgctcgcgcatccttatctcgaggcataccacgaccccgaggacgag
ccagttgcgccgcccctcgatccagagttctttgagttcgaccttcacaaggacgacatc
agccgcgagcagctgaaggaactcctgtacgatgagatcatgtcattccgtcccccgcct
atggtgtga

DBGET integrated database retrieval system